KEGG   Shewanella frigidimarina: Sfri_3669Help
Entry
Sfri_3669         CDS       T00395                                 

Definition
aldose 1-epimerase (EC:5.1.3.3)
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
sfr  Shewanella frigidimarina
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:sfr00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:sfr00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4350784..4351818
Genome map
AA seq 344 aa AA seqDB search
MVRFSVLEPWQDPRGGEIERVRIDNGIIALEVLSLGGIIRSLWTPDRNGERKNIVLGCDS
VEDYLAQQAHLGAIAGRYSNRIANGKTQYNGHQYQLSVNQASNCLHGGVEGFNRKLWQLG
TLSDGVRLTLTSPDGDMGFPGNCTVQLDYRLVGNNLYIEMLASTDKACPISLTQHSYFNL
DGNRSDTNEQHTLQVDATKYLTMNDVGVPTSIQPTAGSDVDMAKPTPMSVQTERPALAAT
KGFDHCYVLDNPGADLQRFGCLASPNSGRNMTVYTNQPGVQVYGANFLQGTIGKKQRVLS
DHQAVCIEPQMLPDSPNQPDLPGDVWITPGKLYHHITRYQFDAE
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atggtacgttttagtgtgctggaaccttggcaagatccccgtggtggtgagattgagcgg
gttagaattgataatggcatcatcgcacttgaagtattaagtttaggcggcatcattcga
tcattatggactccagatcgcaacggtgaacgtaaaaatatcgtgttaggttgcgacagt
gtcgaagattatctggctcaacaagcccatttaggcgcgatagcaggacgttacagcaat
cgtattgccaatggtaaaacccaatataatggccatcaataccaacttagcgttaaccaa
gcgagcaattgtttacacggtggcgttgaaggctttaatcggaaattgtggcaactcggt
accttaagtgatggcgtccgcttaaccttaacaagcccagacggcgacatgggatttccg
ggcaattgtactgtgcaactcgattaccgtttagtgggtaataacttgtacattgaaatg
ctagctagtaccgataaagcctgtcctattagtttaacccagcacagctactttaattta
gacggtaatcgcagcgacactaatgagcaacatactctccaagtggatgccacaaagtac
ctcacaatgaatgatgttggtgtgccgacctcaatacaacctaccgcaggtagcgatgta
gacatggcaaaacccacgccaatgtcagtacaaaccgaacgcccagcattagccgctact
aagggctttgaccattgttatgtgttagataatcccggtgcggatttacagcgctttggt
tgcttagccagccctaatagtggccgcaatatgacggtttatactaatcagcctggggtg
caggtttatggagcaaactttttgcaaggtacgataggtaaaaagcagcgagtattaagc
gatcatcaagctgtgtgtattgaaccacaaatgctacccgactcgcctaatcagccagac
ttacccggcgatgtatggataacacctggtaagctatatcaccacataactcgatatcag
tttgatgccgaataa

DBGET integrated database retrieval system