KEGG   Shewanella frigidimarina: Sfri_3776Help
Entry
Sfri_3776         CDS       T00395                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sfr  Shewanella frigidimarina
Pathway
sfr00010  Glycolysis / Gluconeogenesis
sfr00020  Citrate cycle (TCA cycle)
sfr00620  Pyruvate metabolism
sfr01100  Metabolic pathways
sfr01110  Biosynthesis of secondary metabolites
sfr01120  Microbial metabolism in diverse environments
sfr01130  Biosynthesis of antibiotics
sfr01200  Carbon metabolism
Module
sfr_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sfr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sfri_3776
   00020 Citrate cycle (TCA cycle)
    Sfri_3776
   00620 Pyruvate metabolism
    Sfri_3776
Enzymes [BR:sfr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Sfri_3776
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H HlyD_D23 RnfC_N PYNP_C Peptidase_M23 HlyD_3 DUF2118
Motif
Other DBs
NCBI-ProteinID: ABI73603
JGI: Sfri3776
UniProt: Q07WL1
Position
complement(4493817..4495814)
Genome map
AA seq 665 aa AA seqDB search
MAELKEVLVPNIDTDAVQVIEICAAVGDYLEKEASIITVESDKATMDIPAPFAGTLAELK
IAVGDTVSEGTLIAMMSAANAAPAKAEAAAPAPKAEAPVAQAAAPAPVTPVAAPSVGSSE
VIEVKVPDIGGDTDVSVIEVLVAVGDSIDVDTGLITLETDKATMDVPSPKAGVVKSVTVA
VGDKVSEGSLVITLEVAGSAPVASAPQAAAPVAQAAQAPAAQAATTTQVQEIHVPDIGDA
NDVDIIEVLVAVGDEITADQGLITLETDKATMEVPAPFAGKLVSLTVKVGDKVSQGSLIA
TIETASSAPVAQAAPTQAEPTQAEPAAAAAAPTMAANRPSTPPVPFHPSAAVTASTGVVH
ASPAVRRLAREFGVDLTKVSGTGRKARILKEDVQAFVKYELSRPKATAATAVSGGAGGLN
VIAAPKVDFSKFGEVEEIPLSRIQKISGPNLHRNWVTIPHVTQFDEADITEMEAFRKQQN
DLAAKKKADYKITPLVFMMKAVAKALAEFPVFNSSLSADGESLIQKKYFHIGVAVDTPNG
LMVPVVRDVDKKGIVELSRELTDISIRARDGKLKSADMQGSCFTISSLGGIGGTAFTPIV
NYPDVAILGVSKSEIKPKWNGKEFEPKLMLPLSLSYDHRVIDGAMAARFSVTLSAILSDI
RTLIL
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
atggctgaattaaaagaagttttggttcctaatatcgatactgatgcagtacaggttatt
gaaatttgtgctgcggttggtgattatcttgaaaaagaagcatcaatcattacagttgaa
agtgataaagcgaccatggacattccagcaccttttgctggtacgttagcagaattaaaa
atcgctgtcggtgataccgtttctgaaggtaccttaattgctatgatgagtgcagctaac
gctgcaccggctaaagcagaagctgctgcgccagcacctaaagctgaagcgccagtggca
caagctgcagctcctgcaccagtgacgcctgttgccgcaccaagtgttggtagctcagaa
gtcattgaagttaaagtacctgatatcggcggcgacactgatgtgtctgtcatcgaagta
ttggttgctgttggcgatagcattgacgttgatacgggtttaattaccttagaaactgac
aaagcaacaatggatgtaccatcacctaaagcaggtgtggttaaatcagtgacagtggcc
gttggcgacaaagtgtctgaaggttcattggttatcacgctagaagtagccggttcagca
cctgttgcatctgcgccacaagctgccgctccggtagcacaagcagctcaggctccagca
gcacaagccgcaacgacaactcaagtacaagaaattcatgtgcctgatattggcgacgcc
aatgatgttgatattatcgaagtgctggttgctgttggtgatgaaatcactgcagatcaa
gggttaattacccttgaaacagacaaagcgacaatggaagtaccagcaccatttgccggt
aaacttgtgtcgttaacggttaaagtgggtgataaagtgtctcaaggtagcttaattgcg
actattgaaaccgctagctcagcaccagtggcacaagctgcgccgactcaagcagagccg
actcaagcagagcctgctgcagcggcagccgcaccaactatggctgccaatcgtccatca
actccaccagtgccgtttcacccaagtgctgctgttactgcgtcaaccggcgttgttcat
gcatcgcctgcggtacgtcgcttagcgcgtgagtttggtgttgatttaaccaaggtttct
ggtactggccgtaaagcgcgtattttgaaagaagatgtgcaagcgtttgtgaaatacgaa
ttatcacgccctaaagcaacggctgctacagcggtttctggtggtgctggtggcttaaac
gtaattgcagcgcctaaagttgatttcagtaagtttggtgaagtggaagaaataccacta
agccgtatccagaaaatatctggtcctaacttacatcgcaactgggtaaccattccacat
gttactcagtttgacgaagctgatatcactgagatggaagcattccgtaagcagcagaac
gaccttgctgccaagaagaaagcggattacaagatcactccattagtgttcatgatgaaa
gccgtcgccaaagcattagctgagttcccagtatttaactctagtttgagtgctgatggt
gagtcgcttattcagaagaagtacttccacattggtgttgctgttgatacaccaaacggc
ctaatggttccggttgtacgtgacgttgataagaaaggcattgttgaattgtcgcgtgag
ttaactgacatttctatccgtgctcgtgacggtaaacttaagtctgctgacatgcaaggt
agctgttttactatttcaagtttaggtggcattggcggtacggcatttacgccgattgtt
aactacccagacgtggcgattttaggtgtatcaaaatctgagattaagccaaagtggaac
ggtaaagagtttgaacctaaattaatgttgccgttatcgttgtcatatgaccatcgcgtt
attgatggcgcaatggctgcacgctttagtgtgaccttgtctgcgatactatcagacatt
cgtacattgattttataa

DBGET integrated database retrieval system