KEGG   Shewanella frigidimarina: Sfri_3815Help
Entry
Sfri_3815         CDS       T00395                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
sfr  Shewanella frigidimarina
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sfr00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Sfri_3815
Enzymes [BR:sfr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Sfri_3815
Exosome [BR:sfr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Sfri_3815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4548883..4550379)
Genome map
AA seq 498 aa AA seqDB search
MVVKKYIVALDQGTTSSRAIVFDHQANIVAVAQREFTQHYPQAGWVEHDPMEIWSSQSSA
LVEVLTRAGISRHDVAAIGITNQRETTIVWNKHTGKPVCNAIVWQCRRSQAICLDLKAQG
VEDLVRQKTGLVLDPYFSASKIKWILDNVEGAREQAEAGDLLFGTVDTWLVWKLTQGEVH
VTEPTNASRTMLFNIHTQEWDEELLDLFNIPRAMLPEVKPSCAIYGYTELAGNHIPVAGM
AGDQQSALFGQLCIEPGMAKNTYGTGCFLLMNTGDKAVESTHGLLTTIAIGADTKVNYAL
EGSVFMGGAVIQWLRDELGLITDACDTQYFADKVDDTNGVYLVPAFVGLGAPYWDADARG
AIIGLTRGANRNHIIRAALEAIAYQSRDVLDAMSKDSNVPLTQIRVDGGAVANDFLMQFQ
ADITGVTVIRPQVTETTAMGAAFLAGLAVGVWKSTDELKTMLSTEREFTSTMDITTRATL
YKGWQKAVSQVSPNGDVG
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atggtggttaaaaaatacattgtcgcgttagaccaaggcactacaagttctcgtgccatt
gtgtttgatcatcaagcgaatattgtcgctgtggcgcaacgtgaatttactcaacattat
ccacaagcgggttgggttgagcatgatccgatggagatatggtcttcgcaaagttcagcg
cttgtggaagtgctgacacgtgctgggatcagccgtcatgatgtcgccgcaattggcata
acaaatcagcgcgagaccacgatagtctggaacaagcatacaggtaagccggtatgtaat
gcgattgtttggcaatgtcgtcgcagccaagctatttgtttggatctaaaagctcaaggt
gttgaagacttagtacgccaaaaaaccggattagtattagatccgtatttttctgcgtca
aaaatcaaatggattttagacaacgtggaaggcgctcgtgaacaagccgaagctggggat
ttattgtttggcacggttgatacctggttagtgtggaaactcacgcaaggtgaagtccat
gtgaccgaaccaaccaatgcatctcggacgatgttatttaacattcacacccaagagtgg
gatgaagagttgcttgatctgttcaatataccgcgggcaatgttacctgaagtgaaaccg
tcttgcgcaatatacggttataccgaactggctggtaatcacattccagtagcgggtatg
gctggcgatcaacaatcggcgttgtttggccagttgtgtattgagcccgggatggcaaaa
aatacttatggtaccgggtgttttttattaatgaacacgggtgataaagcggtagagtca
acccatgggttattaacaaccattgctattggtgctgacacaaaggtgaattatgccctt
gaaggctcggtatttatgggcggcgcggttattcaatggttgcgtgatgagttaggtctt
attaccgatgcttgtgacacccaatattttgccgataaagtggacgacaccaatggtgtt
tacttagtgcctgcatttgttggtttaggtgcgccttactgggatgctgatgctcgaggt
gccattattggcttaacccgtggagctaatcggaatcatattattcgcgcggcattagaa
gcaatagcttaccagtctcgtgatgtgcttgatgctatgagcaaagattctaatgtaccg
ttaacacaaattcgagtggatggtggtgcggtagcaaatgactttttaatgcaatttcaa
gccgatattactggggtcacggttattcgtccgcaagtaacagaaaccacagcaatggga
gcagcatttctagctggcttggccgttggcgtatggaaatcgacggatgaattaaaaacc
atgctgtctaccgaacgggagtttacttcaacaatggatataacgactcgtgcgacgctg
tacaagggctggcagaaagccgtttctcaagtaagccctaatggagacgttgggtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system