KEGG   Shewanella frigidimarina: Sfri_3834Help
Entry
Sfri_3834         CDS       T00395                                 

Gene name
folE
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
sfr  Shewanella frigidimarina
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:sfr00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4573438..4574088
Genome map
AA seq 216 aa AA seqDB search
MALSEAAIKVQAALKDRGLETPMLPKTSTPEERKVKIEHHMREILTLMSLDLTDDSLVDT
PRRIAKMYVDEIFSGLDYENFPKITVIENKMGVDEMVRVQDISLTSTCEHHLVTIDGFAT
VAYLPRTKIIGLSKINRIVRFFSQRPQVQERLTQQVLVALQTLLETKDVAVKMDAVHYCV
KSRGVMDSTSSTTTTALGGIFKSNPATRAEFLHQVK
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atggcactcagtgaagccgcaataaaagtacaagcagcgctaaaagaccgtgggttagaa
accccaatgctgccaaaaacttccacgcctgaagaacgtaaagtcaaaattgaacaccat
atgcgtgaaatcttgaccttaatgtcactcgacctaaccgacgacagcttagttgatact
cctcgtcgtatcgcaaaaatgtatgtcgacgaaatattctctgggcttgattacgaaaac
ttccctaagatcacggttatcgaaaacaaaatgggtgttgatgaaatggtgcgtgtacaa
gacatcagtcttaccagcacctgcgaacaccatttagtgaccatagatggcttcgcaacg
gtggcctatttgccacgcacaaaaattattggcttgtctaaaatcaatcgtatcgtgcgc
ttcttttcccaacgcccacaagtacaagagcgcctaacccaacaagtgttagtggcactg
caaactctacttgaaactaaagacgttgcggtaaaaatggatgcggtacattactgtgtt
aaatctcgtggtgtaatggactcaaccagctcaactaccactacagcgcttggtggtatt
tttaaatcaaacccagctacccgcgccgagtttttacaccaagtaaaatag

DBGET integrated database retrieval system