KEGG   Shewanella frigidimarina: Sfri_3990Help
Entry
Sfri_3990         CDS       T00395                                 

Definition
sucrose phosphorylase (EC:2.4.1.7)
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
sfr  Shewanella frigidimarina
Pathway
Starch and sucrose metabolism
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:sfr00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4758234..4759715
Genome map
AA seq 493 aa AA seqDB search
MKNNVQLITYVDRIAHSDLKGLKQVLDTELHDLFGGVHLLPFYYPIDGSDAGFDPIDHAK
VDERLGDWNDVKQIGQQYDIMADLIVNHMSAESTEFQDVLANGKSSVYWDLFLTKDSVFP
DGLSAENQAKIYRPRPGSCFTTYKLADGTQAEFWTTFTSNQIDINVHTAAGQAHLNKVLT
RFHESKVDLIRLDAAGYAIKKPGTSCFMIEESFEFVDELAKKANSLGMTTLAEIHSHYMT
QLDIAKRVDMVYDFALPPLILHSLFSQDVSALSHWLSIAPRNCVTVLDTHDGIGIIDAGP
VGNKAGLLTAAEIDNLVNRIHSNSKGESLQATGAAASNVDLYQVNCTYYDALGQNNIDYL
IARSVQFFAPGIPQVYYTGLLAVPNAMELLNQTQVGRDINRPYLQVSDIQTAMQKPVVKA
LCELITLRNKVDAFNGEFTMTNQANQLDLCWVHGDSSAKLSVNFATKEAHINIVESQQST
HIVLTDLLAKHSG
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaataatgttcagctgatcacttacgtagatcgtatagcgcactcagacttaaaa
ggactcaaacaggttctagacacagaactgcatgatctctttggtggcgtacatctgtta
cctttttactatccgattgacggcagcgatgctggctttgaccctatagaccatgcaaaa
gtagatgaacgtcttggtgattggaatgacgtaaagcagattggtcaacaatacgacatc
atggccgacttaatcgttaaccacatgtctgcagagtctaccgagtttcaagacgtgctt
gccaacggtaaaagctcagtttattgggatttatttttaaccaaagatagcgtatttcca
gacggtttaagcgcagaaaaccaagctaaaatttatcgcccacgtccggggagttgtttc
accacctataaactcgccgacggtacacaagccgagttttggacgacttttacctcaaat
caaattgatattaatgtgcataccgctgcaggtcaggcacatttaaacaaggtgctaacg
cgttttcatgaaagcaaagtcgatcttattcgtcttgacgctgcgggttatgccattaaa
aaaccaggcactagctgttttatgattgaagaatcatttgaatttgtcgatgagttagcc
aaaaaagccaacagcctaggcatgaccacccttgccgaaattcactcgcattacatgacc
cagctcgatattgctaagcgcgtagacatggtgtacgactttgcgctgccgccattgatt
ctccacagcttatttagccaagatgtcagtgcattaagccattggctatccattgcccca
cgcaactgtgtcacggtattagacacccatgacggtattggcattattgacgctggcccg
gtcggcaataaagcaggtttattaacagctgcagaaattgataacttagttaatcgcatc
catagcaatagcaaaggtgaaagcctgcaagcaacgggcgcagcagccagcaatgtcgac
ctataccaagttaattgcacctactacgacgcgcttggccaaaataacattgattattta
atcgctcgaagcgtgcagttttttgctcccggtattccgcaggtgtattacaccggctta
ctggcagtgcctaatgccatggagttactgaatcaaactcaagtaggtcgcgatattaac
cgaccttatctacaggtaagcgacattcaaacagccatgcaaaaaccggttgttaaagcg
ctatgtgagctgatcactctacgcaataaagtcgatgcctttaatggtgagttcaccatg
acaaaccaggctaatcagttagatctttgttgggtgcatggcgacagttcagccaagtta
agcgttaattttgccaccaaagaagcccatatcaacatcgttgaatctcagcaatcgact
cacattgtactgactgatttactggctaaacacagcggataa

DBGET integrated database retrieval system