KEGG   Syntrophobacter fumaroxidans: Sfum_0114Help
Entry
Sfum_0114         CDS       T00418                                 

Definition
(GenBank) Pyruvate synthase
  KO
K00170  pyruvate ferredoxin oxidoreductase beta subunit [EC:1.2.7.1]
Organism
sfu  Syntrophobacter fumaroxidans
Pathway
sfu00010  Glycolysis / Gluconeogenesis
sfu00020  Citrate cycle (TCA cycle)
sfu00620  Pyruvate metabolism
sfu00633  Nitrotoluene degradation
sfu00640  Propanoate metabolism
sfu00650  Butanoate metabolism
sfu00680  Methane metabolism
sfu01100  Metabolic pathways
sfu01120  Microbial metabolism in diverse environments
sfu01130  Biosynthesis of antibiotics
sfu01200  Carbon metabolism
Module
sfu_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sfu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sfum_0114
   00020 Citrate cycle (TCA cycle)
    Sfum_0114
   00620 Pyruvate metabolism
    Sfum_0114
   00640 Propanoate metabolism
    Sfum_0114
   00650 Butanoate metabolism
    Sfum_0114
  Energy metabolism
   00680 Methane metabolism
    Sfum_0114
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Sfum_0114
Enzymes [BR:sfu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Sfum_0114
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_C DXP_synthase_N DUF3268
Motif
Other DBs
NCBI-ProteinID: ABK15817
JGI: Sfum0114
UniProt: A0LEG5
Position
complement(138194..139078)
Genome map
AA seq 294 aa AA seqDB search
MELPEVEYILPGTRTCAGCGLPIAYRHMLKALGPKMIMTHPACCLTILHGIYPKTPVAIN
AVNNTFAGTAASASGLVAGLKATGRTDYTVVAMAGDGGTFDMGIQALSGAAERETDFIYV
CYDNEAYMNTGVQRSSATPSGAVTTTTPVIPKEQAKKDFIQIMEAHDPAYLATMCSSYPA
DIYNKFLKAKAIKGTRFIHMAVPCPTGWSFPTKDTVKIGRLAVESAVVVLYEVENGAFRL
TGKSLSMARSGKKQPVNEYLEMQGRFKRISAEQLAEFQRQIDVKWERFRKRAGF
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atggaactcccggaagtcgagtatattctgccgggcacccgcacctgcgccggctgcggc
ctgccgatcgcctatcgccatatgctcaaggctctcggccccaagatgataatgacccat
cccgcctgctgcctgacgatcctccacggcatctaccccaagacccctgtcgccatcaac
gccgtcaacaacaccttcgccggcaccgcggcatcggcatccggactggtcgccgggctc
aaggcaacgggacgcaccgactacacggtggttgccatggccggggacgggggaaccttt
gatatgggcatccaggccttgagcggtgccgccgaacgcgagacggatttcatttacgtc
tgctacgacaacgaagcctatatgaataccggggtccagcgttcaagcgccacgcccagc
ggcgcggtcacgacgacaacccccgtcatccccaaggagcaggccaaaaaagacttcatc
cagatcatggaagctcacgacccggcctacctcgccaccatgtgctcgtcgtaccccgcg
gacatttacaacaagttcctcaaggcaaaggccatcaaggggacccgcttcatccacatg
gcggtgccctgccccacgggatggagcttcccgaccaaagacacggtcaaaatcgggcgg
ctcgccgtggagtcggcggtcgtggtcctctatgaggtcgagaacggcgcgttcaggctt
acgggaaagagcctcagcatggccaggagcggcaagaagcagccagtgaatgaatatctc
gagatgcagggccgattcaagcggatctctgcggagcaattggccgaattccagcgtcag
atcgatgtcaagtgggaaaggttcaggaagcgcgcggggttctga

DBGET integrated database retrieval system