KEGG   Syntrophobacter fumaroxidans: Sfum_0115Help
Entry
Sfum_0115         CDS       T00418                                 

Definition
(GenBank) ketoisovalerate ferredoxin oxidoreductase, alpha subunit (EC:1.2.7.7)
  KO
K00169  
pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
sfu  Syntrophobacter fumaroxidans
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sfu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sfum_0115
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sfum_0115
   00020 Citrate cycle (TCA cycle)
    Sfum_0115
   00620 Pyruvate metabolism
    Sfum_0115
   00640 Propanoate metabolism
    Sfum_0115
   00650 Butanoate metabolism
    Sfum_0115
  Energy metabolism
   00680 Methane metabolism
    Sfum_0115
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Sfum_0115
Enzymes [BR:sfu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Sfum_0115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(139127..140335)
Genome map
AA seq 402 aa AA seqDB search
MGQTLILTGTQAAALAAKLCRVQVIAAYPITPQSKIPEVLSEYVEKGELQAEFVRVESEH
SAMGVCISASLVGARVFTATAANGLAYMHEQLHWAAGARVPVVMPVTNRGLGAPWTILND
MQDTIAQRDTGWMQFYCMNNQEVLDQVILAYKVAEQLMVPTMVCFDGFRLSHTMMPVSIP
AQSDVDKYLPPYEPLHSIDSGNPVNINPVVMTDPLRGPDGELCPSYMGFRFRLQETMESA
LPVIAEAGRSFAERFGRSYEDNLHRYRTEDAEFIFLTMGSLASEASDTVDILRERGVKAG
VVGIRVFRPFPAASLVEATCRAKSVAVVEKAISYGYEGALATELKAALFSRNGHRPVIYN
YITGLGGKDVKPTDLLEVAQEIINGAAGNIPQEKPRWLGYGV
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
gtgggacagacactcattttaaccggaactcaggccgcggcactggcggccaagctatgc
cgagtgcaggtcatagcggcttatccgatcacgcctcaatcgaaaatccccgaagtgctt
tccgagtatgtggaaaagggtgagctgcaagcggaattcgtccgggtcgaaagcgagcat
tcggccatgggagtgtgcatttcggcttcgctggtcggggccagggtctttaccgccacc
gcggccaatgggctggcctacatgcacgaacagctccactgggccgcgggcgcccgtgtt
cccgtggtcatgccggtcaccaaccgcggcctcggtgcgccgtggacgatcctcaacgac
atgcaggacaccatcgcccagcgcgataccggctggatgcaattttactgcatgaacaat
caggaagtcctggaccaggtcattcttgcctacaaggtcgcagagcagctcatggtaccc
acgatggtctgctttgacggcttcaggctctcgcacacgatgatgcccgtctccatcccg
gcccagagcgatgtcgacaagtaccttcctccctatgagcccctgcactccatcgactcg
ggaaatccggtgaatatcaacccggtggtgatgaccgacccgctcaggggacccgacggg
gaactgtgcccaagctacatgggattccgattccgtttgcaggaaacgatggaatcggcg
cttcccgttatcgccgaagccggtcgatctttcgccgagcgattcggccgctcctacgag
gacaatctccatcgctaccggaccgaggatgccgaattcatctttctcacgatgggttcc
ctcgccagcgaggcgagcgacacggtggacattctgcgtgagcggggtgtgaaggccgga
gtcgtcggcatccgcgtcttccgtccttttcccgctgcatcgctggtcgaggcgacgtgc
agggccaagtccgttgcggtggtcgaaaaggccatcagctatgggtatgaaggcgccctg
gcgacggagctcaaagcggctcttttcagtcgaaacgggcatcgtccggtaatctacaac
tacattaccggcctgggcggaaaggacgtgaaacccacggatctcctcgaggtcgctcag
gaaatcatcaacggcgccgccggaaacattccccaggaaaaaccgcgttggctggggtac
ggtgtctga

DBGET integrated database retrieval system