KEGG   Syntrophobacter fumaroxidans: Sfum_0481Help
Entry
Sfum_0481         CDS       T00418                                 

Definition
(GenBank) phosphomannomutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
sfu  Syntrophobacter fumaroxidans
Pathway
sfu00010  Glycolysis / Gluconeogenesis
sfu00030  Pentose phosphate pathway
sfu00051  Fructose and mannose metabolism
sfu00052  Galactose metabolism
sfu00230  Purine metabolism
sfu00500  Starch and sucrose metabolism
sfu00520  Amino sugar and nucleotide sugar metabolism
sfu00521  Streptomycin biosynthesis
sfu01100  Metabolic pathways
sfu01110  Biosynthesis of secondary metabolites
sfu01120  Microbial metabolism in diverse environments
sfu01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sfu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sfum_0481
   00030 Pentose phosphate pathway
    Sfum_0481
   00051 Fructose and mannose metabolism
    Sfum_0481
   00052 Galactose metabolism
    Sfum_0481
   00500 Starch and sucrose metabolism
    Sfum_0481
   00520 Amino sugar and nucleotide sugar metabolism
    Sfum_0481
  Nucleotide metabolism
   00230 Purine metabolism
    Sfum_0481
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Sfum_0481
Enzymes [BR:sfu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Sfum_0481
    5.4.2.8  phosphomannomutase
     Sfum_0481
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV DUF2218
Motif
Other DBs
NCBI-ProteinID: ABK16181
JGI: Sfum0481
UniProt: A0LFH9
Position
577760..579112
Genome map
AA seq 450 aa AA seqDB search
MDPNVFREYDIRGIVGSEIRDRDVYLLGKTFGTYMVRQGKSRVVVGRDCRLSSDRFRDLL
VEGMLETELDIVDLGVCPTPLLYFALHHLKREGGVMITASHNPPEYNGFKICNGVDTISG
AEIQRIRELMESRDFAGGRGEIRQFAIQEPYIDYVLQSVRPKRSLRIGLDAGNATGGPVA
LPLLRDLGCRVYPLYCEMDGTFPNHEPDPTVMENMRDIQELVVKENLDVGIALDGDCDRL
GVIDHRGEVVFGDKLMILFAREILSRRPGSLFISEVKCSKTLYDDIERNGGRAIMWKAGH
SLIKAKMREVDAVLAGEMSGHVFFKDRYFGFDDGIYSACRLIEILAATGKTIPELLEGVP
PTFSTPEIRIPCPDDIKFEVVEQARRSFAEKQFRIIDVDGARIVFPDGWGLVRASNTQPV
LVLRYEADSPERLDAIRNLVEGTLHAIMNR
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
gtggatccgaacgtctttcgagaatacgatatcaggggtattgtcggttctgaaatccgg
gaccgtgacgtctacctgctgggcaaaaccttcggcacctatatggtccgtcagggaaaa
tcccgggtggtcgtgggaagggactgtcgtctgagctcggatcggttccgggatttgctc
gtggaagggatgctggaaacggagctcgatatcgtcgacctcggcgtttgtcccactccg
ctcctctattttgcgcttcatcacctgaagcgggagggcggcgtgatgatcaccgccagc
cacaaccctccggaatacaacggcttcaagatctgcaacggtgtcgacaccatctcggga
gctgaaatccagcgaattcgggaactcatggagtcaagggattttgcgggcggaagggga
gaaatcaggcagttcgccattcaggagccttacatcgactacgtgctccaaagcgtgcgc
ccgaagcggagcctgcgaatcggcctggacgcggggaacgccaccgggggacccgtcgct
ctccccttgctccgcgacctgggatgccgggtctacccgctctactgcgaaatggacggc
accttccccaatcacgagcccgaccccacggtcatggagaacatgcgggacatccaggaa
ctggttgtgaaggagaatctggatgtcggcattgcacttgacggagactgtgaccggttg
ggggtcatcgatcaccggggcgaagtcgttttcggagacaaactgatgatcctgttcgcc
cgcgaaattctgtcccgccgtccgggttcgctgttcatctccgaggtgaaatgctcgaag
acgctgtatgacgatatcgagcgcaacggcggccgggcaatcatgtggaaggcggggcat
tctttgataaaagccaagatgagggaagtcgacgcggttctggccggagagatgagcggc
cacgtcttcttcaaggatcgatatttcggctttgacgacggaatctattccgcctgccgc
cttatcgagatcctggcggctaccgggaagaccattcccgagctgctggaaggcgtgccg
ccgaccttcagcactcccgaaatcaggatcccctgtcccgacgatatcaaattcgaggtg
gtggaacaggccaggcgatcgtttgcagaaaaacaattccggattatcgatgtggacggc
gcgcgcatcgtatttcccgacggctgggggctcgtgcgcgcatccaacacccaacccgtt
ctggtgcttcgctacgaggccgattcccccgaacgcctggatgcgatccgcaacctggtg
gaagggacactccacgcgatcatgaaccgttga

DBGET integrated database retrieval system