KEGG   Syntrophobacter fumaroxidans: Sfum_0498Help
Entry
Sfum_0498         CDS       T00418                                 

Definition
magnesium chelatase
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
sfu  Syntrophobacter fumaroxidans
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:sfu00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
601631..603469
Genome map
AA seq 612 aa AA seqDB search
MMSFARIVSHARAKLALILNLIDPGIGGVLFLGHKGTGKSTLARSARNLLPEGAPFVEVP
LNVTEDALLGGIDLEEAVRTGERSMRAGLLQRSLGGVLHIDDVNLLNQDLLSLILNNREG
DGIVGAIEEGSISRRLCLFAGMNPEEGAVSAATIDHFGLCAVFETPEKQGTKTRALAHNC
PDEALDLRLRRIEAKVKKRIERARGLLERVAVPSQMRALAVEACIEAGIEGHRGDIALLR
AARAYAAFCGARALSAKHVKRVVPLALIHRRRSAAPPREEEMREQQSQIPRAEEREQAGD
SSRGGAEAREAPADGDGSQAHSSPKSREGHSREEVFPVGDSFKVKRMRFAKDRIERNASG
RRTNTRFSGKAGRYVGSILRAKKLDVAVDATLRAAAPWQILRGRTGNLIVSREDLRFKRR
EKKMGHLVVFAVDCSGSMGARRRMIETKGAVLSMLTDCYHKRDKVSLIAFRKDGAEVVLP
PTSSVELASRRLAEIPVGGKTPLPAALVAIYNLIRRVLIKEPALRIVAAVVSDGRANQGI
TGIPVPEEVERCAGLLKGMKNTDFIVVDTEDKSGIMRLDLAQRLAVSLDADYFTCDTLKA
EILAELVSRRKN
NT seq 1839 nt NT seq  +upstreamnt  +downstreamnt
atgatgtcatttgccaggatagtcagtcacgcgagggcaaaactggctctcatcctcaac
ctgatcgaccccggcatcggaggcgttctcttccttgggcacaaggggacggggaaatcc
actctggcgcgttcggcgaggaatctccttcctgaaggcgcaccattcgtggaagtgcct
ttaaacgtcaccgaagatgccctgttgggaggcatcgacctcgaggaagccgtccggacg
ggggagcggtccatgcgggccggcctcctccagcgctcgcttggaggcgtgctgcacata
gacgacgtcaatcttttgaaccaggacctcttgagtctaatactcaacaatcgggaggga
gacggaatcgttggcgcaatagaggaaggctcgatctctcgacggctctgcctctttgcc
ggcatgaatcccgaggagggagcggtttcggccgcaacgatcgatcatttcggcctgtgt
gccgtcttcgagacgccggaaaaacaaggcacgaagacgagggcgctcgcgcacaattgc
ccggatgaggccctcgatctgcgcttgcgccggattgaggcgaaagtgaagaagagaatc
gaacgagcgcgggggctgctcgaacgggtcgccgtgccttcccaaatgcgggcacttgcc
gtggaggcgtgcatcgaagccggtatcgagggacaccgcggggatatcgccctgctcagg
gccgcgcgggcctatgccgcgttttgtggtgctcgtgccttgtcggccaaacatgtcaag
agggtcgttcccctggcgttgatccacagaaggcgaagtgccgctcctccgagggaagag
gagatgcgggagcagcagtcgcagataccgcgggccgaggagcgggaacaggcgggggat
tcgagccgcggcggggccgaggcccgggaagcgcccgcggatggagacgggagccaggcc
cattcgtctccgaagtcccgggaagggcactcccgggaagaggtcttcccggtgggcgat
tccttcaaggtgaaaaggatgcgcttcgcgaaggacaggatcgaacgcaatgcttccggg
agaagaacgaacacgcgattctcgggcaaggcgggacggtacgtcgggagcatactccgg
gcgaaaaagctcgacgtcgctgtcgatgccactttgcgtgcggcagcgccctggcagatc
ctgcgaggtcgtacgggaaacctcatcgtttcgcgcgaagacctgcggttcaaaaggcgc
gaaaagaaaatggggcacctggtggtcttcgccgtggattgttccggttccatgggggcc
aggaggaggatgatcgagaccaagggggcggtcctttcgatgctgaccgactgctatcac
aagcgggacaaggtgtccctgatcgcattccgcaaggacggggccgaggtcgtcctgccg
ccgacctccagtgtcgaactggcatccaggaggctcgcggaaattcccgtcggagggaaa
actccgctcccggccgctctggttgcgatttacaacctcatcaggcgagtgctcataaag
gaaccggctctcagaatcgtcgcggccgtggtgagcgatgggcgggccaatcagggcatc
accggcattcccgtgcccgaggaggtcgaaagatgcgccgggctcctcaaaggcatgaaa
aacacggacttcatcgtggtcgacacggaagacaaatccggcatcatgcggctggacctg
gcgcaacggctcgccgtgagtctcgacgcggattattttacctgcgacaccctgaaggcc
gaaatcctcgccgagctggtttcgcgcagaaagaactga

DBGET integrated database retrieval system