KEGG   Syntrophobacter fumaroxidans: Sfum_0544Help
Entry
Sfum_0544         CDS       T00418                                 

Definition
(GenBank) ketoisovalerate ferredoxin oxidoreductase, delta subunit
  KO
K00171  pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
sfu  Syntrophobacter fumaroxidans
Pathway
sfu00010  Glycolysis / Gluconeogenesis
sfu00020  Citrate cycle (TCA cycle)
sfu00620  Pyruvate metabolism
sfu00633  Nitrotoluene degradation
sfu00640  Propanoate metabolism
sfu00650  Butanoate metabolism
sfu00680  Methane metabolism
sfu01100  Metabolic pathways
sfu01120  Microbial metabolism in diverse environments
sfu01130  Biosynthesis of antibiotics
sfu01200  Carbon metabolism
Module
sfu_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sfu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sfum_0544
   00020 Citrate cycle (TCA cycle)
    Sfum_0544
   00620 Pyruvate metabolism
    Sfum_0544
   00640 Propanoate metabolism
    Sfum_0544
   00650 Butanoate metabolism
    Sfum_0544
  Energy metabolism
   00680 Methane metabolism
    Sfum_0544
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Sfum_0544
Enzymes [BR:sfu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Sfum_0544
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4 Fer4_6 Fer4_7 Fer4_9 Fer4_16 Fer4_21 Fer4_10 Fer4_15 Fer4_2 Fer4_8
Motif
Other DBs
NCBI-ProteinID: ABK16243
JGI: Sfum0544
UniProt: A0LFP1
Position
662714..663010
Genome map
AA seq 98 aa AA seqDB search
MNKAREDKFTQARSALCKGEAGRTGDWRSVRPRIDHAKCIPSKNRRPSCFICWLYCPEGV
VKRSIPVEIDLDYCKGCGICAEECPGKAIEMVEEHEEA
NT seq 297 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaggcgagagaagacaaattcactcaggcacgatccgcgctctgcaagggagag
gcgggcaggaccggcgactggaggtccgttcggccccggatagaccacgcgaagtgtatt
ccgtcgaaaaaccgccgtccgtcctgtttcatttgctggctgtactgtccggagggtgtg
gtgaagcgatccatccctgttgaaatcgatctcgactattgcaagggatgcggaatctgc
gccgaggagtgtccgggcaaggccatagaaatggttgaagaacatgaggaggcatga

DBGET integrated database retrieval system