KEGG   Syntrophobacter fumaroxidans: Sfum_0721Help
Entry
Sfum_0721         CDS       T00418                                 

Definition
putative agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
sfu  Syntrophobacter fumaroxidans
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:sfu00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Sfum_0721
Enzymes [BR:sfu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Sfum_0721
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
876930..877853
Genome map
AA seq 307 aa AA seqDB search
MTSEKSVGSGLRECLGPHCSFLGLAVPECAFENAGAVIIPVPYDATTTYRAGTREGPRAI
LAASRELEPYDEETCTEAYRHGIATLEELPVVVSSPRDMLDSVRVVGAQVLRSGKLPVLL
GGEHLLSLGMIEAAADHFGDLSILHLDAHADLREQYQGSPYSNACIMRHGAALAPVVQVG
IRSLTAEEHEFIRAKKIPCFFAHDLHRDPSLYARVIPCLGKRVYLSIDLDVFDPAVMPSV
GTPEPGGLSWYEVIDLLRAVFRERQVVGFDVMELLPVPCFAAPDFLAARLVYKLLSFFFA
GAARPPC
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgacttccgaaaaatcggtggggtccgggctgagggaatgcctgggaccccattgttca
tttttgggccttgccgttcccgagtgtgcgttcgagaatgccggagcggtcatcatcccg
gtgccttacgacgccacgacgacttatcgggcggggacgcgtgaagggccgcgagccatt
ctggccgcgtccagggaactcgaaccctacgacgaggaaacgtgcaccgaggcctatcgg
cacgggatcgccaccctggaggaattgccggtggtggtgagctccccgcgcgatatgctg
gacagcgtgcgggttgtgggggcgcaagtccttcgctcgggaaagctgcccgtgctgctc
ggcggcgagcacctgctgtcgctgggcatgatcgaggcggcggccgatcacttcggggat
ttgagcattctccaccttgatgcccacgcggacctgcgggagcaataccagggcagtccc
tacagcaacgcctgcatcatgcggcacggcgcggcgttggctcccgtggtgcaggtcggg
atacgatcgctgaccgccgaagaacatgagttcatccgggcaaagaagatcccctgcttc
tttgcgcatgacctccaccgggatccgtcgctgtacgctcgtgtcatcccgtgcctcgga
aagcgggtttatctcagcatcgatctggacgtcttcgacccggcggtgatgccgtcggtg
ggtacacccgaaccgggcggtctgtcgtggtatgaagtgatcgacctgctcagggccgtc
ttccgggaacggcaggtggtcggattcgatgtgatggagctgctgccggtgccctgtttt
gccgctccggatttcctggccgcccgcttggtgtacaagctgctttcgttcttttttgcg
ggtgccgctcgtccgccttgctaa

DBGET integrated database retrieval system