KEGG   Syntrophobacter fumaroxidans: Sfum_0721Help
Entry
Sfum_0721         CDS       T00418                                 

Definition
(GenBank) agmatinase
  KO
K01480  agmatinase [EC:3.5.3.11]
Organism
sfu  Syntrophobacter fumaroxidans
Pathway
sfu00330  Arginine and proline metabolism
sfu01100  Metabolic pathways
Module
sfu_M00133  Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:sfu00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Sfum_0721
Enzymes [BR:sfu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Sfum_0721
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase UPF0489
Motif
Other DBs
NCBI-ProteinID: ABK16419
JGI: Sfum0721
UniProt: A0LG67
Position
876930..877853
Genome map
AA seq 307 aa AA seqDB search
MTSEKSVGSGLRECLGPHCSFLGLAVPECAFENAGAVIIPVPYDATTTYRAGTREGPRAI
LAASRELEPYDEETCTEAYRHGIATLEELPVVVSSPRDMLDSVRVVGAQVLRSGKLPVLL
GGEHLLSLGMIEAAADHFGDLSILHLDAHADLREQYQGSPYSNACIMRHGAALAPVVQVG
IRSLTAEEHEFIRAKKIPCFFAHDLHRDPSLYARVIPCLGKRVYLSIDLDVFDPAVMPSV
GTPEPGGLSWYEVIDLLRAVFRERQVVGFDVMELLPVPCFAAPDFLAARLVYKLLSFFFA
GAARPPC
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgacttccgaaaaatcggtggggtccgggctgagggaatgcctgggaccccattgttca
tttttgggccttgccgttcccgagtgtgcgttcgagaatgccggagcggtcatcatcccg
gtgccttacgacgccacgacgacttatcgggcggggacgcgtgaagggccgcgagccatt
ctggccgcgtccagggaactcgaaccctacgacgaggaaacgtgcaccgaggcctatcgg
cacgggatcgccaccctggaggaattgccggtggtggtgagctccccgcgcgatatgctg
gacagcgtgcgggttgtgggggcgcaagtccttcgctcgggaaagctgcccgtgctgctc
ggcggcgagcacctgctgtcgctgggcatgatcgaggcggcggccgatcacttcggggat
ttgagcattctccaccttgatgcccacgcggacctgcgggagcaataccagggcagtccc
tacagcaacgcctgcatcatgcggcacggcgcggcgttggctcccgtggtgcaggtcggg
atacgatcgctgaccgccgaagaacatgagttcatccgggcaaagaagatcccctgcttc
tttgcgcatgacctccaccgggatccgtcgctgtacgctcgtgtcatcccgtgcctcgga
aagcgggtttatctcagcatcgatctggacgtcttcgacccggcggtgatgccgtcggtg
ggtacacccgaaccgggcggtctgtcgtggtatgaagtgatcgacctgctcagggccgtc
ttccgggaacggcaggtggtcggattcgatgtgatggagctgctgccggtgccctgtttt
gccgctccggatttcctggccgcccgcttggtgtacaagctgctttcgttcttttttgcg
ggtgccgctcgtccgccttgctaa

DBGET integrated database retrieval system