KEGG   Syntrophobacter fumaroxidans: Sfum_0745Help
Entry
Sfum_0745         CDS       T00418                                 

Definition
acetyl-CoA synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
sfu  Syntrophobacter fumaroxidans
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sfu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sfum_0745
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sfum_0745
   00620 Pyruvate metabolism
    Sfum_0745
   00640 Propanoate metabolism
    Sfum_0745
  Energy metabolism
   00680 Methane metabolism
    Sfum_0745
Enzymes [BR:sfu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Sfum_0745
Lipid biosynthesis proteins [BR:sfu01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Sfum_0745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(913400..915352)
Genome map
AA seq 650 aa AA seqDB search
MAGNIFPVPESWAKSAFCDNETYLKMYEQSVKDPEGFWGEHAKRIDWFQPWTKVKSGSFE
GDVRFKWFENGKLNVAYNCLDRNLAKRGDQVAIIWEGDDPKVSKYITYRELHDQVCRFAN
VLKAQGLKKGDRATIYLPMIPELAVAMLACARIGVVHSIVFAGFSPESLAGRILDCGGKV
VITADEGLRGGKPIPLKENTEEALKKCPDVQKVIVVKHTGGKVPVVPGRDVDWTEAIKAA
SPDCPPEVMDAEDPLFILYTSGSTGKPKGVLHTTGGYLVYTALSHQYVFDYHDGDIYWCT
ADIGWVTGHSYIIYGPLANGATTVMFEGIPNYPDWSRFWNVVDKHKINIFYTAPTAIRAL
MRQGEAPVRATSRKSLKLLGTVGEPINPEAWLWYYNNVGEQRCPIVDTWWQTETGGILIT
PLPGATALKPGSATRPFFGVQPAIIDPEGKMLDGPGSGYLIIKESWPGMLRTVYGDHERF
KQTYFSNYPGLYFTGDGARRDEDGYYWITGRVDDVINVSGHRLGTAEVESALVAHPAVAE
SAVVGFPHDIKGQGIYAYVTLKANWEHSDELRQELVKWVRKEIGPIATPDYIQWAPGLPK
TRSGKIMRRILRKIAANEIDNLGDTTTLAEPAVVEDLIKNRQAVASSGKA
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
atggcaggcaacatttttcccgttcccgagtcgtgggccaagtcggcattctgcgacaat
gagacgtatttgaagatgtatgagcagtcggtcaaggatccagagggattctggggggaa
cacgcgaagcgcatcgactggtttcagccgtggacgaaggtaaagagcggttccttcgaa
ggagacgtccggttcaagtggttcgagaacggcaagctcaacgtagcctacaactgcctt
gaccggaacctcgccaagcggggcgatcaggtggccatcatctgggaaggtgacgacccg
aaggtgagcaagtacatcacctatcgcgagctccacgaccaggtctgccgttttgcgaat
gtgctgaaggcacagggcttgaaaaaaggcgaccgggcgaccatctatcttcccatgatc
cccgagcttgcggtggcgatgctggcctgcgcccgcataggcgtagtccattccatcgta
tttgccggtttctctccggaatctctggccgggcgtatcctggactgcggcggcaaagtg
gtgatcacggccgatgaaggactgcgcggcggcaagccgattccattgaaggaaaacacc
gaggaagccctcaagaagtgtccggatgtccagaaagtcatcgtcgtcaaacacaccggc
gggaaggttccggtggtgcctgggcgagacgtcgactggaccgaggcgatcaaggctgcg
tcccccgactgtccgccggaagtcatggacgccgaggaccccctcttcattctctacact
tccggttccaccggcaagcccaagggtgttctgcacaccacgggcggctacctggtatat
acggctctgtcgcaccaatatgtcttcgactatcacgacggggacatctactggtgtacg
gccgatatcggctgggtcacgggccacagctacatcatttacgggccgctggccaacggc
gccacgacggtcatgttcgaaggcatcccgaactatccggactggtcccggttctggaac
gtggtcgacaagcacaagatcaacatcttctacaccgctccaacggcgattcgagcgctg
atgcgccaaggcgaagcccccgtgagggcgacgtcccgcaagtcgctgaaactgctcggg
accgtcggggagccgatcaaccccgaagcctggctctggtattacaacaacgtgggcgag
cagcggtgccccatcgtcgatacatggtggcagacggaaacgggcggcatcctcatcact
cccctgcccggcgccaccgcgctcaaacctggctcggccaccaggccctttttcggagtc
cagcccgccatcatcgatcccgaaggcaagatgctcgatggtccggggtcgggctatctg
atcatcaaggaatcgtggccgggaatgctcaggaccgtgtacggcgatcacgaacgcttc
aaacagacctacttctccaattaccccggactctacttcaccggggacggggcacgtcgc
gacgaggacggctactactggatcacgggacgcgtggacgacgtcatcaacgtgtcgggg
caccgcctcggaacggccgaagtcgaaagcgccctcgttgcccatcccgccgtggcggaa
tcggcggtggtcggcttcccgcacgacatcaagggccaggggatctacgcctacgtgacg
ctgaaggcgaactgggaacattccgatgagctccgccaggaactcgtcaagtgggttcgc
aaggagatcgggcccatcgccacgcccgattacatccagtgggcgccgggccttcccaag
acccggtccggcaaaatcatgcgccgcatcctgcgtaagatcgccgccaatgaaatcgac
aacctcggcgatacgacgaccctcgccgaaccggcggtggtggaagacctcatcaagaat
cgccaggcggtcgcctcgtccggcaaggcgtag

DBGET integrated database retrieval system