KEGG   Syntrophobacter fumaroxidans: Sfum_0829Help
Entry
Sfum_0829         CDS       T00418                                 

Definition
alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
sfu  Syntrophobacter fumaroxidans
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sfu00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Sfum_0829
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sfum_0829
  Lipid metabolism
   00071 Fatty acid degradation
    Sfum_0829
  Amino acid metabolism
   00350 Tyrosine metabolism
    Sfum_0829
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Sfum_0829
   00626 Naphthalene degradation
    Sfum_0829
Enzymes [BR:sfu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Sfum_0829
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1028166..1029164)
Genome map
AA seq 332 aa AA seqDB search
MRAMVLKACAPMETKPLEWLEVDDPLPGPGEVRIRVKACGICRTDLHVVEGELPSLGRPV
IPGHQIVGLVDSIGTGCRRFKIDDRIGAAWLRQTCGTCVFCRSGQENLCENARFTGYHAP
GGYAEYAVVPEDFAYPIAPVFSDAEAAPLLCAGIIGYRSLRRSQCKAGDTLALYGFGSSA
HIVIQIAVHWGCTVYAVTRGERHRRLALELGAKWAGSDAERLPAPADSAIIFAPAGNLVP
VALSRLRKGGTLALAGIYMTDIPGMNYEKHLFYEKNVHSVTANTREDGMELLRIAASIPI
RPQVQTFAVQEANEALLKLKNDRIEGSGVLVF
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgagagcaatggttctgaaggcgtgtgccccgatggaaacgaagcccctcgaatggctg
gaggtggatgatccactgcccggccccggggaagtgcgcatcagggtgaaagcgtgcggc
atatgcaggaccgacctgcacgtggtggagggggaattgccttccctcgggcgtcccgtc
attccgggccaccagatcgtcggcctggtggattccatcggaaccggctgtcggcggttc
aagatcgatgacagaatcggggcggcatggttgagacagacctgtggaacatgcgtcttc
tgccgctccgggcaggagaatctgtgtgaaaacgccagattcaccggctatcatgcccct
ggcgggtacgccgaatatgccgtggtcccggaagatttcgcctatcccattgcgcccgtc
ttcagcgacgcggaagccgcaccgctgctgtgcgccggcattatcggttaccggagcctg
aggcgcagccagtgcaaagccggcgacaccctggccctgtacggattcggttcgtcggcg
cacatcgtcattcagatcgccgtccactggggttgcacggtgtatgccgtcacccgcggc
gagagacatcggcggctggcactggagctcggggccaaatgggccggatccgacgcggaa
cggctgcccgccccggcggacagcgccatcatcttcgcccccgcgggaaacctcgtgccc
gtggcgctgagccgtttgcgcaagggcggtacgctggcccttgccgggatctatatgacc
gacattcccgggatgaattacgagaagcaccttttctacgaaaaaaacgttcacagcgtc
acggccaatacgcgggaagacggcatggagctgctcaggatcgccgcgtccatacccatt
cgcccgcaggtgcaaacgtttgccgtgcaggaagccaacgaagcgctgctcaagctcaag
aatgaccggattgagggctcgggggtgctggtattctga

DBGET integrated database retrieval system