KEGG   Syntrophobacter fumaroxidans: Sfum_1477Help
Entry
Sfum_1477         CDS       T00418                                 

Definition
phosphoglycerate mutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
sfu  Syntrophobacter fumaroxidans
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:sfu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sfum_1477
   01230 Biosynthesis of amino acids
    Sfum_1477
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sfum_1477
  Energy metabolism
   00680 Methane metabolism
    Sfum_1477
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sfum_1477
Enzymes [BR:sfu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Sfum_1477
Exosome [BR:sfu04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Sfum_1477
  Exosomal proteins of melanoma cells
   Sfum_1477
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1834219..1834389
Genome map
AA seq 56 aa AA seqDB search
MKKVVLSRHGESEWNRENRFTGWTDVALNENGVREAVDAGRTLPVPGVRGSLVGLR
NT seq 171 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagtcgtgttgtcgaggcacggagagagtgaatggaacagggagaatcgtttc
accggctggacggacgtggcgctcaacgaaaacggggtccgtgaagccgtggatgcgggg
cgcaccctgccggttcccggcgttcgggggagtcttgtcggtttgcgttga

DBGET integrated database retrieval system