KEGG   Syntrophobacter fumaroxidans: Sfum_1477Help
Entry
Sfum_1477         CDS       T00418                                 

Definition
phosphoglycerate mutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
sfu  Syntrophobacter fumaroxidans
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:sfu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sfum_1477
   01230 Biosynthesis of amino acids
    Sfum_1477
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sfum_1477
  Energy metabolism
   00680 Methane metabolism
    Sfum_1477
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sfum_1477
Enzymes [BR:sfu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Sfum_1477
Exosome [BR:sfu04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Sfum_1477
  Exosomal proteins of melanoma cells
   Sfum_1477
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1834219..1834389
Genome map
AA seq 56 aa AA seqDB search
MKKVVLSRHGESEWNRENRFTGWTDVALNENGVREAVDAGRTLPVPGVRGSLVGLR
NT seq 171 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagtcgtgttgtcgaggcacggagagagtgaatggaacagggagaatcgtttc
accggctggacggacgtggcgctcaacgaaaacggggtccgtgaagccgtggatgcgggg
cgcaccctgccggttcccggcgttcgggggagtcttgtcggtttgcgttga

DBGET integrated database retrieval system