KEGG   Syntrophobacter fumaroxidans: Sfum_1479Help
Entry
Sfum_1479         CDS       T00418                                 

Definition
aldehyde ferredoxin oxidoreductase
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
sfu  Syntrophobacter fumaroxidans
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:sfu01200]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:sfu00030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1834985..1836739
Genome map
AA seq 584 aa AA seqDB search
MTGETREQFKVLVVDLPAGRGAITSLEGRDSLAGGSGLTAMLFDRYGLPDRPWDDPEQPL
IFAIGPLTGYFPLMSKTVCAFKSPYHDQYAESHAGGRSALSLRFAGFDALVIRGKALAPS
CLSVGSRHLELKDVHFLWGMDLLRTGKMLRRMYEGSGHRSILRIGPAGENGSAMACINVD
TYRHFGRLGCGAVMGAKNLKGIVILGDGSSPLPEGKAYPKLFTEVYRKMTDTDMMEKYHN
FGTPINMAILNGISALPIRNLQKTSDPGIEGITGETFARDTLLRNAACAGCPVGCVHLGF
VRERFMEENRYLYRQVSYDHEPIFAAGAMLHVTNAFSVLTLLDTVEREGLDIMSAGVALA
WATEALEKGIVTTRETIVPLKFGDETAYREGFHHLGAASNDFYRLLAQGTMKAAEHYGGA
DFACVLGQEMAGYATGEVFFVSQALGLRHSHLDAGGYSYDQKDKEPDVDGAVRFLVQDEQ
ARVLLTSMVSCLFARGVYGDQVLSDCLRSLGYLNLADGLGDVSRNVRKLRWRTRLRTGFD
PRTVSIPKRFLEVETWRGRIDSAYLNALKDAYAGAILALGEEDA
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atgaccggagagaccagggaacaattcaaagtgctcgtcgtcgaccttcccgccgggcga
ggcgccataacctcactcgaaggcagggacagcctggccggcggcagcggcctgacggcc
atgctcttcgacagatacgggctcccggaccgaccgtgggacgatccggaacagccgctc
atcttcgccatcggccccctcaccggctacttcccgctcatgagcaagaccgtctgcgcc
ttcaagtccccctatcacgatcagtacgccgaaagccacgccggaggacgttcggccctc
tcgctcaggtttgcgggcttcgatgccctcgtgatccggggcaaggctctcgcgccgtcc
tgcctgtcagtgggctcgcgtcacctcgagctcaaggacgtccatttcctttggggcatg
gatcttctcagaaccggcaagatgttgcggcgcatgtacgaagggtcggggcaccggagc
atccttcggatcggtcccgcgggtgagaacggctcggccatggcctgcatcaacgtggac
acgtaccgccacttcggaagactcggctgcggcgctgtcatgggagcgaaaaacctcaag
ggcatcgtcatcctgggcgacggttcgtccccgcttcccgaagggaaggcctatccgaag
ctgttcaccgaagtataccggaagatgaccgacacggacatgatggagaagtaccacaac
ttcgggacccccatcaatatggcgatcttgaacggtatcagcgcccttcccatcaggaac
ctccagaaaacgagcgatcccggcatcgaagggatcaccggggaaactttcgcccgggat
acgctgcttcgcaatgccgcctgcgccgggtgccccgtgggttgcgtgcacctcgggttc
gtccgcgagaggttcatggaagaaaaccgctacctctaccggcaggtctcctacgaccac
gagccgatctttgccgccggggccatgctccacgtgaccaacgccttctccgtgcttacc
ctcctcgatacggtggaacgggaggggctcgacatcatgtccgccggcgttgccctggcg
tgggccacggaggcccttgaaaaagggatcgtcaccacccgcgagaccatcgtccccctc
aaattcggggatgaaaccgcctaccgggaagggttccaccacctcggcgccgcttccaac
gatttctaccggctcctcgcgcaaggaactatgaaggctgccgagcattacggaggagcc
gacttcgcctgcgtgctcggccaggagatggccggctatgccaccggcgaggtgttcttc
gtctctcaggcactcggccttcggcactcccacctggacgcgggcggctattcctacgat
cagaaggacaaggagcccgatgtcgacggcgcggtccggttcctggtccaggacgaacag
gccagggtgctgctcacctccatggtgagctgtctcttcgccaggggcgtgtacggagac
caggtcctctccgattgcctgcgctccctcggctacctcaaccttgccgacggcctcggc
gatgtctcccgcaacgtccggaaactgcggtggcgaacacgcctgcgcacgggcttcgac
ccgcgaaccgtgtcgatacccaagcgcttcctggaagtcgagacatggaggggccggatc
gactcggcgtacctgaatgcgctcaaggacgcctacgcgggggcgatcctcgctctcgga
gaggaggatgcgtga

DBGET integrated database retrieval system