KEGG   Syntrophobacter fumaroxidans: Sfum_1645Help
Entry
Sfum_1645         CDS       T00418                                 

Definition
response regulator receiver modulated CheB methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
sfu  Syntrophobacter fumaroxidans
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:sfu02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:sfu02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2016749..2018758
Genome map
AA seq 669 aa AA seqDB search
MNVLLLDPQQKYAERLRDLSSVVEGANVISADEIRICPSDSANIDIIVAGYDRANPRTLD
ALLEWRSHPHTYLVPCWILADARSFEAVCQWPRLSVDRFDEQLDIPAFCSWLETVAEWQQ
NRMQLPGTNRFISHSPLELTTSLALRKASGKLSLFDEEGGEGAFLLRDGYLTGSTLKHLS
GTEAFLEFLTWSKGSYLWEPLDTIEFTDQSSPIEFMFHEALKLFREANLLYHFVPDLNRS
LTKTESESALDDGAVYYFAELKVLYNLIDGKATVRQVVEASPLSQLRTLCCLSKWFSLGD
VAVVPEESPIPRRGLLIVDDSHLMCKALRDVFAKDPRFEVLGFAHDGLQALELIEQLKPD
VLTLDMQMPRMDGLTALKHIMIRNPRPVVVVSAFTKETSLLTYQSFKYGAVDVLTKPSGG
NPGSREHESRLIRDRVAQASCVRIEAAQYIRSGGRSKPAEKDGAFSPEARDRAEHASNGL
AVILCGSGGFPSLLKMLFSIENTDRLPTLLGGIALSKKAVESMVPNMEKDSSMRMTELTP
PGGILLPNSSYLFSCEDSFHLVRENDQTMARCDQDSAAEHRPFDRLLFSLGDGFGEHAMA
VLLSGTGHDGIEGMEHVRRAGGKTYVLSPEACLEPDLPRRILQYGFAQEVKSASELASLL
QNVGSENGK
NT seq 2010 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtcctgctgctggatccgcaacaaaaatacgctgaacgactccgcgacctgtct
tcggtcgtcgagggcgccaacgtgatcagcgctgacgaaatccgcatctgtccttcggat
tccgcaaacatcgacatcatcgtggccggctacgaccgggccaacccgagaacgctcgac
gcgctgctcgagtggcggtcgcatcctcacacgtacctcgttccctgttggatacttgcc
gacgcacggtccttcgaggcggtctgtcagtggccccgcctgtccgtggaccgtttcgat
gagcaactcgatataccggccttctgcagttggctggaaaccgtggccgaatggcagcaa
aaccgcatgcaactcccggggaccaatcgcttcatttcgcacagtcccctggagctcacc
acctccctggccctgcgaaaagccagcgggaaactgtccctgttcgacgaggaaggcggc
gagggcgctttcctgttgcgcgacggctacttgaccggatcgacgctcaaacacctctcg
ggaacggaagccttcctcgagttcctcacctggtcgaaagggagctacctgtgggaaccg
ctggacacgatcgagttcaccgaccagagcagtccgatcgagttcatgtttcacgaagcc
ctgaagctgttccgcgaagccaaccttctctatcatttcgttccggacttgaaccgttct
cttacaaagacggaatcggaatcggcgcttgacgacggggccgtgtactatttcgccgaa
ctgaaggtgctttacaacctcatagacggcaaggccaccgttcggcaggttgtcgaagcc
tccccgctgtcccagcttcgcaccctgtgctgtctgtcgaagtggttctcgctgggcgac
gtggcagtggtacccgaagaaagcccgatccccaggaggggcctgctcatcgtcgatgac
tcccacctcatgtgcaaagcgctacgggatgttttcgccaaggatccccgcttcgaggtg
ctcggattcgcccatgacggactccaggcattggagctcatcgagcagctcaagcccgac
gtcttgacgttggacatgcagatgccccgcatggatgggctgaccgcgctcaaacacatc
atgatccgcaatcccaggccggtggtcgtggtcagtgccttcacaaaggaaacgtccctg
ctgacttaccagtccttcaagtacggcgccgtggacgtcttgaccaagccgtcgggaggc
aatcccggttccagggaacatgaaagccgcctcatccgcgaccgggtcgcgcaggcttcc
tgcgtgcgcatcgaggcggctcagtacattcgcagcggcggacggagcaagcccgctgag
aaagacggcgcattttctccggaggcgcgcgaccgggcagagcacgcgtcgaatgggctc
gcggtcatcctgtgcggctcgggaggttttccgtctctgctgaagatgcttttttccatc
gagaataccgatcgccttcccacgctgctgggtggtatcgcgttgtccaaaaaggctgtg
gaatccatggtgcccaacatggagaaggactcctccatgaggatgacggaactgacgccg
ccgggcggaatcctgctgccgaacagttcctacctcttctcatgcgaagactcctttcac
ctcgtcagggagaacgaccaaaccatggcccgatgcgaccaggacagcgcggccgagcat
cggcccttcgatcgcctgctcttcagcctcggagacggtttcggggagcatgccatggcg
gttctgctctccggtacgggccacgatggaattgaaggcatggaacatgtgcgaagagcg
ggaggaaagacgtacgtgctgtcacccgaggcatgtctcgaacccgacctgccccgcagg
attttgcagtacggctttgcgcaggaagtgaaatcggcatcggagctggcatcactcctg
caaaacgtaggaagcgaaaacggcaaatga

DBGET integrated database retrieval system