KEGG   Syntrophobacter fumaroxidans: Sfum_1703Help
Entry
Sfum_1703         CDS       T00418                                 

Definition
(GenBank) succinyl-CoA synthetase (ADP-forming) beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
sfu  Syntrophobacter fumaroxidans
Pathway
sfu00020  Citrate cycle (TCA cycle)
sfu00640  Propanoate metabolism
sfu00660  C5-Branched dibasic acid metabolism
sfu01100  Metabolic pathways
sfu01110  Biosynthesis of secondary metabolites
sfu01120  Microbial metabolism in diverse environments
sfu01130  Biosynthesis of antibiotics
sfu01200  Carbon metabolism
Module
sfu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sfu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sfu00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Sfum_1703
   00640 Propanoate metabolism
    Sfum_1703
   00660 C5-Branched dibasic acid metabolism
    Sfum_1703
Enzymes [BR:sfu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Sfum_1703
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 CPSase_L_D2 GARS_A ATP-grasp
Motif
Other DBs
NCBI-ProteinID: ABK17390
JGI: Sfum1703
UniProt: A0LIY8
Position
complement(2082762..2083928)
Genome map
AA seq 388 aa AA seqDB search
MKIHEYQAKQLFQKYGVPIPRGKAAFTVEEAKAVGAELGTFPVVVKAQIHAGGRGKGGGV
KLAKSAAEVDQYAKGILGMTLVTHQTGPEGRLVKKLLVEEGLPIEKELYLSVLPDRGTSK
IVFMASEAGGMDIEEVAAKTPEKIIKVFIDPLLGFKGFHANELAYGLNLKPELIKQFNAM
VAALYKLCTDYDCSLVEINPLVLTSDNRVIALDGKINFDDNAMYRHKDIQEYRDLDEEDP
FEIEASKFELNYIKMPGGNIGNMVNGAGLAMATMDIIQQAGAAPANFLDVGGGASAEQVE
NGFRIILADPAVKGVLINIFGGILRCDRLANGVVEAAKKVGIRVPVVIRMEGTNVEQGRE
ILAKSGLNLINAKDVADAAQKIAAVAKG
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattcacgagtatcaagccaaacagttgttccagaagtacggagtccccattcct
cgtgggaaagcggctttcaccgttgaggaagcgaaggcggtcggcgctgaattgggaacg
tttccggtggtagtgaaggcccaaatccacgcgggtggacgcggtaagggcggtggtgta
aagctggcgaagagtgccgccgaagtcgatcagtatgcgaagggcattctgggcatgact
ttggtgacgcatcagaccggcccggaaggccgccttgtgaagaagctcctggtggaagaa
ggtttgcccatcgagaaggagctctacctcagcgtcctccccgacaggggaacctcgaaa
atcgtgttcatggcaagcgaagccggtggtatggacattgaagaagtcgccgccaagacg
cccgagaagatcatcaaggttttcatcgatccgctgctgggcttcaagggtttccacgcc
aacgagcttgcctacgggttgaatttgaaacccgaactgatcaagcagttcaacgcgatg
gtcgccgcgctctacaagctgtgcacggactatgactgttcgctggtggaaatcaacccg
ctcgtcctgacatcggacaacagggtcatcgccctggacgggaagatcaactttgacgac
aacgccatgtatcgccacaaggatatccaggaatacagagacctcgacgaagaggatccg
ttcgagatcgaggcgtcgaagtttgagctcaactacatcaagatgccgggtgggaatatc
ggcaacatggtgaacggcgccggtctggccatggcgaccatggacatcatccagcaagcc
ggtgcggcccccgcgaacttcctggacgtcggcggcggtgccagcgccgagcaggtggag
aacggattccggatcattctcgccgatcctgcggtcaagggtgtgctcatcaatattttc
ggcggcatccttcggtgcgacaggctggccaacggggttgtggaagcggccaagaaagtg
ggcatcagggttcccgtggtcattcgcatggaagggaccaacgttgagcaaggtcgggag
atcctggcaaaatccgggttgaacctcatcaatgccaaagatgtcgcagacgccgcccaa
aagattgcagcggttgccaaagggtag

DBGET integrated database retrieval system