KEGG   Syntrophobacter fumaroxidans: Sfum_1771Help
Entry
Sfum_1771         CDS       T00418                                 

Definition
(GenBank) tryptophan synthase, beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
sfu  Syntrophobacter fumaroxidans
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sfu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Sfum_1771
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sfum_1771
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Sfum_1771
Enzymes [BR:sfu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Sfum_1771
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(2166074..2167306)
Genome map
AA seq 410 aa AA seqDB search
MKTNQRAAPVALRQPIHASMPDSHGHFGPFGGRYVGETLMPAIIELEKAYARISALPGFQ
EELRRLLKHYAGRPTPLFPAARLTEKIGGAAIYLKREDLAHTGAHKINNTLGQALLARWM
GKRKVIAETGAGQHGVATATVAALFGMECRIFMGTEDVRRQSANVQRMELLGAEVVPVES
GTGTLKDAMSEAMRYWVSAVRDTFYVIGSVAGPHPYPMMVRDFQRVIGDETKEQMLEAEG
RLPDMLVACVGGGSNAMGLFYPFIDDPGVEMVGVEAAGYGIATGKHAATLGAGSVGVLHG
SKSFVLQDEAGQIMEAHSISAGLDYPGVGPEHSLLKEMGRARYEAVDDAGALHAFHELCA
LEGIIPALESSHALARAMVEASGQPRTRLIVVNLSGRGDKDLGIVQQARA
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgaagacgaaccagcgggcagcccctgttgccttgcggcagcccattcatgcaagcatg
cccgatagtcatggccacttcggaccctttggggggcgctatgtgggggaaacgctgatg
ccggccatcatcgaactggaaaaggcttacgcgaggatttccgcgcttccgggtttccag
gaggaattgcggcggcttctgaagcactacgccggccgtcccacgccgctctttccggcc
gcccgcctcaccgagaagatcggaggggccgcgatctatctgaaacgcgaagacctggcc
cacaccggcgcccacaagatcaacaacacactcgggcaggcgctcctggccaggtggatg
ggcaaacgcaaggtcatcgccgaaaccggcgcgggacaacatggggtggccacggcgacg
gtcgcggccctcttcgggatggaatgccgaatcttcatggggaccgaggacgtgcgccgg
cagtctgccaacgtgcagcgcatggaactgctcggagcggaagtggtgcccgtggaatcg
gggacggggaccctcaaggatgccatgagcgaggcgatgcgctactgggtttccgcggtg
cgggacacgttctacgtcatcggctccgttgcgggaccgcacccctacccgatgatggtt
cgggatttccagcgggtgattggcgacgagacgaaagagcagatgctcgaagccgaagga
cgccttcccgacatgctggttgcctgcgtggggggaggcagcaatgcgatgggcttgttc
tatccgttcatcgacgatcccggggtcgagatggtcggcgtggaggccgcgggctacggc
atcgccaccggcaagcacgcggcaacccttggggcgggttcggtgggggtcctccatggc
tccaagtcattcgtcctccaggatgaagccggccagatcatggaggcgcattccatttcg
gcagggctcgattaccccggtgtgggccccgaacattccctcctcaaggaaatggggcgc
gcgcgttacgaggctgtggacgatgccggagccctgcatgccttccacgaactgtgcgcc
ctggaggggatcattccggccctggaaagttcccacgcattggccagagccatggtggaa
gcatccggccagccccgcacccggttgatcgtcgtcaatctctcgggtcgcggcgacaag
gacctgggcatcgtgcaacaggcaagagcctga

DBGET integrated database retrieval system