KEGG   Syntrophobacter fumaroxidans: Sfum_1773Help
Entry
Sfum_1773         CDS       T00418                                 

Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
sfu  Syntrophobacter fumaroxidans
Pathway
sfu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sfu01100  Metabolic pathways
sfu01110  Biosynthesis of secondary metabolites
sfu01130  Biosynthesis of antibiotics
sfu01230  Biosynthesis of amino acids
Module
sfu_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sfu00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Sfum_1773
Enzymes [BR:sfu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Sfum_1773
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS His_biosynth QRPTase_C
Motif
Other DBs
NCBI-ProteinID: ABK17460
JGI: Sfum1773
UniProt: A0LJ58
Position
complement(2168101..2168898)
Genome map
AA seq 265 aa AA seqDB search
MSDFLSTILEEKKREVEQRKRTISEEFLEERSASAMERRSLCRALATPGRRGINIIAEVK
RGSPSRGVMNPGLDAAQFARRYESCGAAAVSVLTDAGFFHGKAGDLRSARAAVKIPVLRK
DFIVSRYQIFESAVMGADAVLLIVRAISPELLGECLRLCRRIGLDALVEVHSAEELDAAS
EAGAVLIGMNNRDLSTFTTDIRTSIQLVRRMRPGQVAVSESGIRCREQIDRLLDAGIWNF
LIGESLVTAPEPEAVLAHLFGAYAA
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgtctgatttcttgagcaccatcctggaagagaagaaacgcgaagtggagcagcgaaaa
aggacgatttcggaggagttcctcgaggagcgttccgcctcggccatggagcggagaagc
ctgtgccgggctctggctacccctggacgccgggggatcaacatcatcgccgaggtcaaa
cgtggttcgccttcgcgcggggtcatgaatcccggactcgatgcggcacagttcgcaaga
cgttacgagagctgcggggcggccgccgtttcggttctgaccgatgccggtttcttccac
ggcaaggccggcgacctgaggagcgccagggcggccgtgaagattcccgtgttgcggaaa
gacttcatcgtttccaggtaccagattttcgagtccgccgtgatgggcgcggacgccgtg
ctgttgatcgtccgggccatttcaccggaactgctcggagaatgcctccgtctatgccgc
cggatcgggctcgacgcccttgtggaggttcattcggcggaagagctggatgcggcatcg
gaggccggggcggttctcatcggcatgaacaaccgggacctgagcacttttacaacggac
atccggacctcgatacaactggtccgccgaatgcgcccggggcaggttgccgtgtcggaa
agcggcattcggtgccgcgagcagatcgaccggctgctcgacgccgggatttggaacttc
ctgatcggggaaagcctggtgaccgcgccggaacctgaagcggtcctggcccatctgttc
ggagcctacgcggcttga

DBGET integrated database retrieval system