KEGG   Syntrophobacter fumaroxidans: Sfum_1784Help
Entry
Sfum_1784         CDS       T00418                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
sfu  Syntrophobacter fumaroxidans
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sfu00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Sfum_1784
Enzymes [BR:sfu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Sfum_1784
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2179092..2180264
Genome map
AA seq 390 aa AA seqDB search
MGSRTISILGSTGSIGESTLEVVRQFPDRFRVIALGAGRNIKLLREQIRAFRPLSVSVLD
SNLADELDRSLKGDAYRPEILFGSDGYDRVAAHPEAGTLVSAMVGAAGLLPTLTAIRAGK
RLALANKETLVVAGEIVMALAAEHEVEILPVDSEHSAIFQSLQGNHRDALKRILLTASGG
PFLNKTREELAMVTPQAALCHPNWSMGRKITIDSATLMNKGLEVIEARWLFGVPVDRIAV
HVHPESIVHSMVEYVDGSVIAQMGIPDMKIPIAYALTYPERLPVRSPSLDLFRLQKLSFY
PPDEERFPCLRLAFDACRKGSTYPAVLNAANEVAVGAFLDEKIAFPDIPGVIETAMGKHK
APAKPDLDAVIAADRWARVETERLIDDIRR
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgggttcaaggacgatcagcattctggggagcaccggttccatcggcgaaagcaccctt
gaggttgtacggcagtttccggatcgattccgcgtcatcgcgctcggtgcgggccggaac
atcaagctgctgcgagagcagatcagagccttcagacccctgtcggtttccgttctggat
tcgaacctcgccgacgagctcgatcggtccttgaaaggcgacgcctatcgcccggaaatc
ctcttcggttccgacggctacgaccgagtggccgcgcatccggaggcgggaacgctcgtt
tccgcgatggtgggcgcggcagggctcctgccgaccctgaccgcgatcagggcgggcaag
cggttggcgctcgccaacaaggagaccctcgtggtggctggagagatcgtgatggcgctt
gccgccgagcacgaggtcgagatcctgcccgtcgacagcgagcacagcgccatttttcaa
tcgttgcagggcaaccaccgcgacgcgctgaagcgcattctcctcacggcctccggaggc
cctttcctcaacaagacgcgtgaagagctggctatggtaacgccccaggcggcgctgtgt
caccccaactggtccatggggcgcaaaatcaccatcgattccgcaaccctcatgaacaag
gggttggaggtcatcgaagcacggtggctgttcggagtgccggtggaccggatcgcggtg
cacgtgcaccccgagagcatcgtccactccatggtggaatacgtggacggctcggtaatc
gcgcagatgggcatccccgacatgaagattcccattgcctacgcgctgacgtatcccgaa
cgactgcccgtgcggagtccgtccctcgatctgttccggcttcagaaactgtctttctat
cctccggacgaggaacgcttcccatgtcttcgcctggcttttgatgcctgtcggaagggt
tcgacgtatccggccgttctcaacgccgccaacgaggtagcggtgggcgccttcctggat
gagaagatcgcctttccagatattcccggggtgatcgaaacagccatgggcaagcacaaa
gcaccggcaaagccggacctcgacgccgtcatcgcagcggaccggtgggcgagggtggag
accgagcggctgatcgacgatataagacgctga

DBGET integrated database retrieval system