KEGG   Syntrophobacter fumaroxidans: Sfum_1836Help
Entry
Sfum_1836         CDS       T00418                                 

Definition
D-cysteine desulfhydrase
Orthology
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
sfu  Syntrophobacter fumaroxidans
Pathway
Cysteine and methionine metabolism
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:sfu00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2240490..2241488)
Genome map
AA seq 332 aa AA seqDB search
MSIGIDEMPRIEIGFFPTPLVEVRRLAAVLGGPRLFMKRDDLTGLALGGNKTRKLEFLLG
DALSRGCDTVITGGAAQSNHCRQTAAAAAAVGLECHLALGGEEPPLVNGNLLLDRLFGAV
VHWCGEQRKGERIPEIAAGLRALGRRVYIIPYGGSDAVGAMGFVAAVRELKQQLASRNEK
IDTVIIPSSSGGTHAGLTVGIDAFDFPAQVIGIGIDKGVSGGGSYESELAVLANRIAGTL
GLQANYDADRFRMRYEYLGAGYGVVGDLEREAIRLLARCEGILADPVYTGRALGGMIDMI
RGKEFAPGDTVLFWHTGGVPALFEYAGELHAG
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgagcatcggaatcgacgagatgcccagaattgaaatcggtttcttcccgacgccgctg
gtcgaagtcaggagacttgccgctgttctcggagggccgcgccttttcatgaaacgcgac
gacctgaccgggctggcgctgggcggcaacaagaccaggaagctcgaattcctgctggga
gatgccttgagccgaggttgcgatacagtgatcacaggcggcgccgctcaatccaatcac
tgccggcagacggcggccgcggccgccgcggtcggcctggaatgccatctcgcgcttggc
ggcgaagagccgccgctggtgaacggaaacctgctcctcgaccgtctgttcggcgccgtc
gttcattggtgcggagaacagcgcaaaggcgaacgcattccggaaatcgcggcagggctg
cgtgcactcgggcgcagggtctatatcatcccttacggggggtccgatgcggtcggcgcg
atgggcttcgtggcagccgtccgcgagctcaaacagcaacttgcctcgcggaacgaaaag
atcgacaccgtgatcattccgtcgagttccggcgggacccacgcgggtctcaccgtggga
atcgatgcgttcgattttccggcacaggtgatcggcatcgggatcgacaaaggggtgtcg
ggcgggggttcatacgaatccgaactggcggtcctggccaaccggattgccgggacgctc
gggctgcaggcgaactacgacgccgaccggttccggatgcgctatgaatacctgggtgcc
ggatacggggtggtgggcgacctcgagcgcgaggcgatccgcctgctggcgcgatgcgaa
gggatcctggccgatccggtctacacggggagagcgctgggcggcatgatcgacatgatc
cgcgggaaggaattcgcgcccggcgatacggtgctgttctggcacacggggggcgtgccg
gcgctcttcgagtatgcgggcgagctccatgccgggtga

DBGET integrated database retrieval system