KEGG   Syntrophobacter fumaroxidans: Sfum_1909Help
Entry
Sfum_1909         CDS       T00418                                 

Definition
recombinase D (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
sfu  Syntrophobacter fumaroxidans
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:sfu00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Sfum_1909
Enzymes [BR:sfu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Sfum_1909
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2328598..2330796)
Genome map
AA seq 732 aa AA seqDB search
MAEQIRGLVERLTYSAEENGYSVLKVKIPGRRELVTVVGNFVSVTPGEVLLMEGSWTVHS
RFGEQFQVERYETTMPSTEVGIRKYLGSGLIRGIGAKMADRIVDRFGVDTLEVIENEPER
LREVEGIGAYRLDRIRKAWEEQRDIRDVMVFLRTHGVNAAYAARIFKHYGKSSLEAVKEN
PYRLAMDVSGIGFLTADRIAQSLGFTADSPLRAEAGVLFVLHRSSEEGHVCVPHEWLVEQ
CRELLQIPSEVLRDAVSRLTADRRLVQESLPPQAATRFGEDRAVTLRGYHVAETEVARRL
TQLQTYRPFRRGVDPEAAVKWLKNKLPFKPAPLQEEAVKRALTDKVVVITGGPGTGKTTL
VRAILAVFREMHARICLAAPTGRAAKRLSETTRYSAGTIHRLLEYSPQAGGFVRNELKPL
PADLVIVDETSMLDLLLMHYLLKAVPPQATLVLVGDADQLPSVGPGNVLKDIIDSGRFPV
VRLDEVFRQARQSRIVVNAHLVRQGKFPQMENEREGLQDFYFIAKEDPEEVCRVILKLCT
ERIPQRFGLDPVEDIQVLSPMHRGAVGAQRLNTALQEALNPETRFVQRGDRTFRLHDKVM
QVRNNYDKDVFNGDLGRIAKIDFEEQLVEVDIDGRRVPYDFSELDELVLAYAVSIHKAQG
SEYPAVVFPLLTQHFMMLRRNLLYTAITRARKLVVVVGSRKALAIAVRNNDTDRRFTLLR
ERLEGVVFTSPE
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
atggcggaacaaatcagaggcttggtggaacgcctcacctacagcgcggaggagaacggg
tacagcgtcctcaaggtcaaaatcccgggcaggcgggaactcgtgacggtagtggggaat
ttcgtgtcggtgacccccggcgaggtgctcctcatggaaggttcctggacggtgcattcc
cgtttcggggagcagttccaggtggagcgctacgagacgacgatgccgtccaccgaggtg
ggcatccgcaagtacctgggatccggactgatccggggtatcggggccaagatggcggac
cgcatcgtggaccgtttcggggtggataccctggaagtgatcgaaaacgaacccgaacgg
ctgcgggaggtcgaggggatcggggcgtaccggctggaccggatccgcaaggcgtgggag
gaacagagggacatccgcgacgtgatggtttttcttcggactcacggcgtcaacgcggcg
tatgcggcccgcattttcaagcactatggcaagagctccctggaagcggtcaaggagaat
ccctaccggctggccatggacgtatcggggatcggcttcctcaccgcggaccggatcgcg
cagagcctgggttttacggcggactccccgctgcgggccgaggcgggcgtcctgttcgtg
ctccaccgcagctcggaggaggggcacgtgtgcgttccgcacgaatggctggtcgaacaa
tgccgggagttgctccagattccgtccgaggtgctccgggacgccgtgtcccggctgacg
gccgaccggaggctggtccaggagtccctgccgcctcaagccgcaacccgtttcggtgag
gatcgggccgtcaccctgcggggctaccacgtggcggaaaccgaagtggcccggcggctc
acccagctgcagacgtaccggccgttccggcgcggggtggacccggaggcggcggtcaaa
tggctgaagaacaaactgcccttcaagccggctccgctgcaggaagaggcggtgaagcgc
gccttgaccgacaaggtcgtggtgatcacgggcggccccggcaccgggaagacgaccctg
gtccgggcgattctcgccgtcttcagggaaatgcacgcgcggatatgcctggccgcgccg
acggggagggcggccaagcggttgagcgaaaccacccggtactccgccgggacgattcac
cggctgctcgaatacagccctcaggccggcggtttcgtccgcaacgagctcaaacccctc
ccggcggatctcgtcatcgtcgacgagacctccatgctcgaccttctgctcatgcattac
ctgctcaaggcggtgccgccccaggcgaccctggtgctggtgggcgacgcggaccagttg
ccttcggtggggccggggaacgtgctcaaggacatcatcgattcggggcgatttcccgtg
gtgagactcgacgaagtcttccgccaggccaggcagagccgcatcgtggtcaacgcgcac
ctggtgcggcaggggaagttcccgcaaatggagaacgagcgggagggcctgcaggacttt
tacttcattgcaaaggaagaccccgaggaagtgtgccgcgtgatcctcaaactgtgcacg
gaacgcataccgcagcggttcggtctcgacccggtggaggacatccaggtgctcagcccc
atgcaccggggggccgtcggcgcccagcggctcaacaccgcgctccaggaggcgctcaac
cccgaaacccgcttcgtgcagcggggagaccggacctttcggctgcacgacaaggtcatg
caggtccgcaacaactacgacaaggacgtcttcaacggggacctcgggcgcatcgcgaag
atcgacttcgaagagcagctggtggaggtggatatcgacggccggcgggtcccatatgac
ttttcggagctcgacgaactggttctcgcctatgcggtcagcatccacaaggcgcagggc
agcgaatacccggccgttgtcttcccgctgctcacccagcatttcatgatgcttcggcgc
aatctcctctacaccgccatcacccgcgcccgcaagctcgtggttgtcgtggggagcagg
aaggccctcgccatcgccgttcggaacaacgacaccgaccggaggttcacgctgctgcgc
gaacgtttggaaggggtcgttttcacgagcccggagtga

DBGET integrated database retrieval system