KEGG   Syntrophobacter fumaroxidans: Sfum_1909Help
Entry
Sfum_1909         CDS       T00418                                 

Definition
(GenBank) helicase, RecD/TraA family
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
sfu  Syntrophobacter fumaroxidans
Pathway
sfu03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:sfu00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Sfum_1909
Enzymes [BR:sfu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Sfum_1909
DNA repair and recombination proteins [BR:sfu03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Sfum_1909
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 HHH_4 AAA_19 UvrD_C_2 HHH_5 Viral_helicase1 AAA_11 Helicase_RecD T2SSE AAA_28 AAA_16 PIF1 HHH_2 PhoH NTPase_1 ArgK DUF2075 AAA_29 TrwB_AAD_bind AAA_22 AAA RsgA_GTPase AAA_23 NACHT ATPase_2 cobW ABC_tran DEAD UvrD_C TsaE AAA_5 Zeta_toxin UvrD-helicase AAA_18 ATPase AAA_33 MobB AAA_24
Motif
Other DBs
NCBI-ProteinID: ABK17594
JGI: Sfum1909
UniProt: A0LJJ2
Position
complement(2328598..2330796)
Genome map
AA seq 732 aa AA seqDB search
MAEQIRGLVERLTYSAEENGYSVLKVKIPGRRELVTVVGNFVSVTPGEVLLMEGSWTVHS
RFGEQFQVERYETTMPSTEVGIRKYLGSGLIRGIGAKMADRIVDRFGVDTLEVIENEPER
LREVEGIGAYRLDRIRKAWEEQRDIRDVMVFLRTHGVNAAYAARIFKHYGKSSLEAVKEN
PYRLAMDVSGIGFLTADRIAQSLGFTADSPLRAEAGVLFVLHRSSEEGHVCVPHEWLVEQ
CRELLQIPSEVLRDAVSRLTADRRLVQESLPPQAATRFGEDRAVTLRGYHVAETEVARRL
TQLQTYRPFRRGVDPEAAVKWLKNKLPFKPAPLQEEAVKRALTDKVVVITGGPGTGKTTL
VRAILAVFREMHARICLAAPTGRAAKRLSETTRYSAGTIHRLLEYSPQAGGFVRNELKPL
PADLVIVDETSMLDLLLMHYLLKAVPPQATLVLVGDADQLPSVGPGNVLKDIIDSGRFPV
VRLDEVFRQARQSRIVVNAHLVRQGKFPQMENEREGLQDFYFIAKEDPEEVCRVILKLCT
ERIPQRFGLDPVEDIQVLSPMHRGAVGAQRLNTALQEALNPETRFVQRGDRTFRLHDKVM
QVRNNYDKDVFNGDLGRIAKIDFEEQLVEVDIDGRRVPYDFSELDELVLAYAVSIHKAQG
SEYPAVVFPLLTQHFMMLRRNLLYTAITRARKLVVVVGSRKALAIAVRNNDTDRRFTLLR
ERLEGVVFTSPE
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
atggcggaacaaatcagaggcttggtggaacgcctcacctacagcgcggaggagaacggg
tacagcgtcctcaaggtcaaaatcccgggcaggcgggaactcgtgacggtagtggggaat
ttcgtgtcggtgacccccggcgaggtgctcctcatggaaggttcctggacggtgcattcc
cgtttcggggagcagttccaggtggagcgctacgagacgacgatgccgtccaccgaggtg
ggcatccgcaagtacctgggatccggactgatccggggtatcggggccaagatggcggac
cgcatcgtggaccgtttcggggtggataccctggaagtgatcgaaaacgaacccgaacgg
ctgcgggaggtcgaggggatcggggcgtaccggctggaccggatccgcaaggcgtgggag
gaacagagggacatccgcgacgtgatggtttttcttcggactcacggcgtcaacgcggcg
tatgcggcccgcattttcaagcactatggcaagagctccctggaagcggtcaaggagaat
ccctaccggctggccatggacgtatcggggatcggcttcctcaccgcggaccggatcgcg
cagagcctgggttttacggcggactccccgctgcgggccgaggcgggcgtcctgttcgtg
ctccaccgcagctcggaggaggggcacgtgtgcgttccgcacgaatggctggtcgaacaa
tgccgggagttgctccagattccgtccgaggtgctccgggacgccgtgtcccggctgacg
gccgaccggaggctggtccaggagtccctgccgcctcaagccgcaacccgtttcggtgag
gatcgggccgtcaccctgcggggctaccacgtggcggaaaccgaagtggcccggcggctc
acccagctgcagacgtaccggccgttccggcgcggggtggacccggaggcggcggtcaaa
tggctgaagaacaaactgcccttcaagccggctccgctgcaggaagaggcggtgaagcgc
gccttgaccgacaaggtcgtggtgatcacgggcggccccggcaccgggaagacgaccctg
gtccgggcgattctcgccgtcttcagggaaatgcacgcgcggatatgcctggccgcgccg
acggggagggcggccaagcggttgagcgaaaccacccggtactccgccgggacgattcac
cggctgctcgaatacagccctcaggccggcggtttcgtccgcaacgagctcaaacccctc
ccggcggatctcgtcatcgtcgacgagacctccatgctcgaccttctgctcatgcattac
ctgctcaaggcggtgccgccccaggcgaccctggtgctggtgggcgacgcggaccagttg
ccttcggtggggccggggaacgtgctcaaggacatcatcgattcggggcgatttcccgtg
gtgagactcgacgaagtcttccgccaggccaggcagagccgcatcgtggtcaacgcgcac
ctggtgcggcaggggaagttcccgcaaatggagaacgagcgggagggcctgcaggacttt
tacttcattgcaaaggaagaccccgaggaagtgtgccgcgtgatcctcaaactgtgcacg
gaacgcataccgcagcggttcggtctcgacccggtggaggacatccaggtgctcagcccc
atgcaccggggggccgtcggcgcccagcggctcaacaccgcgctccaggaggcgctcaac
cccgaaacccgcttcgtgcagcggggagaccggacctttcggctgcacgacaaggtcatg
caggtccgcaacaactacgacaaggacgtcttcaacggggacctcgggcgcatcgcgaag
atcgacttcgaagagcagctggtggaggtggatatcgacggccggcgggtcccatatgac
ttttcggagctcgacgaactggttctcgcctatgcggtcagcatccacaaggcgcagggc
agcgaatacccggccgttgtcttcccgctgctcacccagcatttcatgatgcttcggcgc
aatctcctctacaccgccatcacccgcgcccgcaagctcgtggttgtcgtggggagcagg
aaggccctcgccatcgccgttcggaacaacgacaccgaccggaggttcacgctgctgcgc
gaacgtttggaaggggtcgttttcacgagcccggagtga

DBGET integrated database retrieval system