KEGG   Syntrophobacter fumaroxidans: Sfum_1930Help
Entry
Sfum_1930         CDS       T00418                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
sfu  Syntrophobacter fumaroxidans
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sfu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Sfum_1930
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sfum_1930
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Sfum_1930
Enzymes [BR:sfu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Sfum_1930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2353577..2355082)
Genome map
AA seq 501 aa AA seqDB search
MKIDQFPEHIRPYLVPRAGGEYAYECFSCGREHGIERLLYTCPDCGSVLMIKDLEWSRLK
RIPGSLWREIFDYRSMLTLPALRGIYRYHELIGSVIPPESVVWLGEGYTPVVAANAVLCD
WAGCAFFFKNDGQNPSASFKDRGMASAFSYLNYLIGHRGMEDVLAICASTGDTSASAALY
GSYFVHGVKSAVLLPHGKVTPQQLGQPLGSGARVIEIPGVFDDCMKVVEYLSEHYSVALM
NSKNAWRILGQESYSYEIAQAFDYEIGDLAVFVPIGNAGNITAVLQGFLKLHDLGIIPAL
PAVFGVQSEHANPVYLYYLEPEREKRRFRPVTVRPSVAQAAMIGNPVSMPRVVKLVEEYR
LRAGEDAVRVVEVSEQEIMDAMLTANRNGHIVCTQGGECLAGCRKAVASGMQAAGRRAVL
DATAHALKFSVFQDKYFSDSFEPEYEVVPKAELRNAPVLVSPPDGVPKPVPGREMPPEDF
RRFLAFASGAVAELLGLKRKQ
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgaagatcgaccagtttccggaacatatccggccgtacctggtgccccgggcgggcggc
gagtatgcgtacgagtgcttctcgtgcggtcgggagcacggtatcgaacggctgctctac
acctgtccggactgtggcagcgtattgatgatcaaggacctggaatggagtcgcctgaag
cggattccgggatccttgtggcgcgagatattcgactaccggagtatgctgacgcttcct
gccctgcggggtatctatcggtaccacgagttgatcggttcggtgattccgcccgaatcg
gtggtctggctcggagagggatacacgccggtggtggcggccaacgcggtgctgtgcgac
tgggcgggctgtgccttctttttcaagaacgacggccagaatcccagcgcctcgttcaaa
gaccgcggaatggccagtgctttcagctatctcaactacctcatcgggcaccgcggcatg
gaggatgttctggccatctgcgcatcgaccggcgacacctccgcttcggcggcgctctat
ggctcatatttcgtgcacggagtgaaatccgccgtcttgctgcctcacggcaaggtcacc
ccgcagcagctcggacagccgctcggaagcggtgcccgggtcatcgagatccccggtgtt
ttcgatgactgcatgaaggtcgtcgaatacctttccgagcactactccgttgccctgatg
aattccaagaacgcctggcgtattctgggccaggaatcctacagctatgaaatcgcccag
gcattcgactacgaaatcggggacctggcggtgttcgtgcccatcggcaacgccggcaac
atcacggcggtgctgcagggattcctcaagctccacgacctgggaatcatcccggccctt
ccggccgtgttcggcgtgcagtccgaacacgcgaatccggtctatctctactacctggaa
cccgaacgcgagaagcggcgattccgcccggtgacggtgaggccgagcgtggcccaggcg
gccatgatcgggaacccggtctccatgccgcgcgtggtgaagctggtcgaagaatatcga
ctgcgggcgggcgaggatgcggtgcgggtggtggaggtgagcgagcaggagatcatggac
gccatgctgacggccaaccggaacgggcacatcgtttgcacccagggcggcgaatgcctt
gccggctgccgcaaagccgtcgcttcgggaatgcaggccgccgggcggcgcgccgtcctc
gacgccaccgcgcacgcattgaagttttccgtttttcaggacaaatatttttccgatagc
ttcgaaccggaatatgaagtggtgccgaaggcggagctccggaacgctcccgtgctggtg
tcgccccccgacggcgttccgaagcccgtgccggggcgggagatgcccccggaggatttc
cggcggttcctggcctttgcgtccggcgccgtcgccgagcttctcgggctgaaacggaag
cagtga

DBGET integrated database retrieval system