KEGG   Syntrophobacter fumaroxidans: Sfum_1930Help
Entry
Sfum_1930         CDS       T00418                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
sfu  Syntrophobacter fumaroxidans
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sfu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Sfum_1930
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sfum_1930
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Sfum_1930
Enzymes [BR:sfu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Sfum_1930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2353577..2355082)
Genome map
AA seq 501 aa AA seqDB search
MKIDQFPEHIRPYLVPRAGGEYAYECFSCGREHGIERLLYTCPDCGSVLMIKDLEWSRLK
RIPGSLWREIFDYRSMLTLPALRGIYRYHELIGSVIPPESVVWLGEGYTPVVAANAVLCD
WAGCAFFFKNDGQNPSASFKDRGMASAFSYLNYLIGHRGMEDVLAICASTGDTSASAALY
GSYFVHGVKSAVLLPHGKVTPQQLGQPLGSGARVIEIPGVFDDCMKVVEYLSEHYSVALM
NSKNAWRILGQESYSYEIAQAFDYEIGDLAVFVPIGNAGNITAVLQGFLKLHDLGIIPAL
PAVFGVQSEHANPVYLYYLEPEREKRRFRPVTVRPSVAQAAMIGNPVSMPRVVKLVEEYR
LRAGEDAVRVVEVSEQEIMDAMLTANRNGHIVCTQGGECLAGCRKAVASGMQAAGRRAVL
DATAHALKFSVFQDKYFSDSFEPEYEVVPKAELRNAPVLVSPPDGVPKPVPGREMPPEDF
RRFLAFASGAVAELLGLKRKQ
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgaagatcgaccagtttccggaacatatccggccgtacctggtgccccgggcgggcggc
gagtatgcgtacgagtgcttctcgtgcggtcgggagcacggtatcgaacggctgctctac
acctgtccggactgtggcagcgtattgatgatcaaggacctggaatggagtcgcctgaag
cggattccgggatccttgtggcgcgagatattcgactaccggagtatgctgacgcttcct
gccctgcggggtatctatcggtaccacgagttgatcggttcggtgattccgcccgaatcg
gtggtctggctcggagagggatacacgccggtggtggcggccaacgcggtgctgtgcgac
tgggcgggctgtgccttctttttcaagaacgacggccagaatcccagcgcctcgttcaaa
gaccgcggaatggccagtgctttcagctatctcaactacctcatcgggcaccgcggcatg
gaggatgttctggccatctgcgcatcgaccggcgacacctccgcttcggcggcgctctat
ggctcatatttcgtgcacggagtgaaatccgccgtcttgctgcctcacggcaaggtcacc
ccgcagcagctcggacagccgctcggaagcggtgcccgggtcatcgagatccccggtgtt
ttcgatgactgcatgaaggtcgtcgaatacctttccgagcactactccgttgccctgatg
aattccaagaacgcctggcgtattctgggccaggaatcctacagctatgaaatcgcccag
gcattcgactacgaaatcggggacctggcggtgttcgtgcccatcggcaacgccggcaac
atcacggcggtgctgcagggattcctcaagctccacgacctgggaatcatcccggccctt
ccggccgtgttcggcgtgcagtccgaacacgcgaatccggtctatctctactacctggaa
cccgaacgcgagaagcggcgattccgcccggtgacggtgaggccgagcgtggcccaggcg
gccatgatcgggaacccggtctccatgccgcgcgtggtgaagctggtcgaagaatatcga
ctgcgggcgggcgaggatgcggtgcgggtggtggaggtgagcgagcaggagatcatggac
gccatgctgacggccaaccggaacgggcacatcgtttgcacccagggcggcgaatgcctt
gccggctgccgcaaagccgtcgcttcgggaatgcaggccgccgggcggcgcgccgtcctc
gacgccaccgcgcacgcattgaagttttccgtttttcaggacaaatatttttccgatagc
ttcgaaccggaatatgaagtggtgccgaaggcggagctccggaacgctcccgtgctggtg
tcgccccccgacggcgttccgaagcccgtgccggggcgggagatgcccccggaggatttc
cggcggttcctggcctttgcgtccggcgccgtcgccgagcttctcgggctgaaacggaag
cagtga

DBGET integrated database retrieval system