KEGG   Syntrophobacter fumaroxidans: Sfum_1942Help
Entry
Sfum_1942         CDS       T00418                                 

Definition
trifunctional NADH dehydrogenase I subunit B/C/D
Orthology
K13380  
NADH-quinone oxidoreductase subunit B/C/D [EC:1.6.5.3]
Organism
sfu  Syntrophobacter fumaroxidans
Pathway
Oxidative phosphorylation
Metabolic pathways
Module
NADH:quinone oxidoreductase, prokaryotes
Brite
KEGG Orthology (KO) [BR:sfu00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    Sfum_1942
Enzymes [BR:sfu01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.3  NADH:ubiquinone reductase (H+-translocating)
     Sfum_1942
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2370046..2372409)
Genome map
AA seq 787 aa AA seqDB search
MSDRFLSAADFVLNWSRKYSLWPLFFGLSCCFVEEATAFTPRYDMARFGAEVLRPSPRQA
DLLIVSGTVFKKIAPVVLRLYEQMAEPKWVISMGSCSNCGGMYDVYSVVQGIDQILPVDV
YIPGCPPRPEAVLQGLTLLQKKIAAEERPARSVLHLPGGSQGSTRPVLVDGATKSRDPRG
PGMEGTVIRGTANTPPAFTGSRSDLMWTPPARRIESSEREKELARVLSERFGDAVREEPF
TSDMPTFHVETNRLKDVLGFLKKEASPRFLRLDDLTAVDESARRDRSAYPDWTMVYHLLS
FEPAGRVRLKTGLHGRQPALPSITDIWPSANWYEREVYDLFGIRFEGHPNLRRIMMPHDW
EGHPLRKDYPGRATQMAPYTLGDARVHQPPDGGIFTKDPGGDRLVLNIGPSHVSTHGLLR
YVVSLDGEEISDLELEIGYHHRGVEKIGERQTWHQFIPYCARVDYLAGAANDLPYVMAVE
TLADIKVPERAQVIRVLLSELFRLSNHLVWFATYAHDVGAMTPNFYTFTEREMILDIVEL
ITGGRLHPSWFRLGGVAADLPEGWKEAVDALVRIFPGRLREYESLIRKNPIFKARTQGVG
RISREDAVDWGVSGPNLRACGLEWDLRRKFPYSGYENFEFEVPTAVEGDCYARYLVRVEE
MRQSLRIIEQAAANMPSGRHVTDDYRYVIPDRRDTLKNIESLIHHFVNVTRGPRIPKGEA
YVSCEIPRGEQGYYVVGDGLGYAYRMRIRGPGFANVQVMPLLARGESIADLIAIIGSVDY
ILPDIDR
NT seq 2364 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaccgttttctgagcgcggcggacttcgtgctcaactggtcgcgcaaatacagc
ctttggccgctgtttttcgggctttcctgctgttttgtcgaggaggcgacagccttcacg
ccgcgctacgacatggcccggttcggcgccgaggtgttgcgtccttcacccaggcaggcc
gatctcctgatcgtctccggaacggtgttcaagaagatcgctccggtcgtcctgcgcctt
tacgaacagatggcggagcccaaatgggtgatctccatggggtcctgttccaactgcggg
ggcatgtacgacgtttacagcgtggtgcagggaatcgaccagattttgcccgtggacgtt
tacatccccggttgtccgccaaggcccgaggcggtactgcaggggctcacgcttcttcag
aagaagatcgccgccgaggagcggccggcccgttcggtgctgcatctgccgggaggttcc
caggggagcactcgccccgtattggtggatggtgcgaccaaatcccgcgacccgcgaggt
cccgggatggaagggacggtcatccgcggaacggccaacacccccccggccttcacggga
agccgctccgatctcatgtggacgccgcccgcgcggcgcatcgaatcgagcgaaagggaa
aaggaactggcccgcgtgcttagcgagcgcttcggcgatgcggtccgcgaagagccattc
acctcggacatgcccacgttccacgtcgagacgaaccgcctgaaggatgtgttgggtttt
ctcaagaaggaggcttcaccgaggttccttcgcctggatgacctcacggccgtcgacgag
tccgcccgacgcgaccggagcgcttatcccgactggacgatggtctatcacctcctttcc
ttcgagcccgcggggagagtgcgcctcaagacgggtctccacggccggcagccggccttg
ccgagcattacggacatctggccgtccgcgaactggtacgaacgggaagtgtacgatctt
ttcgggattcgtttcgaggggcatccgaacctgcgccggatcatgatgccccacgactgg
gaagggcatcccctgagaaaggactatcccggacgggccacgcagatggctccgtatacc
ctgggcgatgcccgggttcatcagcctccggacggaggaatattcacaaaagaccccgga
ggggaccggctcgtgctcaacatcggtcccagccatgtcagcacacacggcttgctgcgc
tacgtcgtgtcgctcgacggggaggaaatttccgatctcgagctggagatcggctaccat
catcgcggcgtggagaagatcggagagcgccagacctggcaccagttcatcccttactgc
gcgcgggtggactacctggccggggccgccaacgatctcccctacgtgatggccgtggaa
acgcttgcggacatcaaggttcccgaacgcgcccaggtcatccgggtgctgctcagcgag
ctgttccggttgagcaatcacttggtctggttcgccacctatgcccatgacgtcggcgcc
atgacccccaatttctatacgttcaccgaacgggagatgattctcgacatcgttgagctc
atcaccggggggaggctccatccttcctggttccggcttgggggcgtcgcggcggacctg
ccggagggttggaaggaagccgtggacgctctggtgaggatctttccgggccgcctccgg
gaatacgagagcctcatccggaaaaaccccatcttcaaggccaggacgcagggcgtgggg
cggatttcccgcgaggatgccgtggactggggggtgagcgggccgaacctgagggcctgc
ggtctcgagtgggatcttcgcaggaagttcccctattcgggttatgagaatttcgagttc
gaggttcccacggcggtcgaaggagactgctatgcgcgctacctggtgcgggtcgaggag
atgcgccagagcctgaggatcatcgagcaggcggcggcgaacatgccttccggtcgtcat
gtgacggacgattaccgttacgtgattcccgaccgccgggatacgttgaagaacatcgaa
agcctgatccatcatttcgtcaacgtcacccgcgggccgagaatcccgaagggtgaagcc
tatgtgtcctgcgagattccgcggggcgagcaggggtactacgtggtcggcgacggcctc
ggatacgcgtaccgcatgcggattcgagggccggggttcgcaaacgtccaggtgatgccg
ctcctggccaggggggaaagcatcgcggacctcatcgcgatcatcgggtcggtcgactac
atcctgcccgacatcgatcggtga

DBGET integrated database retrieval system