KEGG   Syntrophobacter fumaroxidans: Sfum_2090Help
Entry
Sfum_2090         CDS       T00418                                 

Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
sfu  Syntrophobacter fumaroxidans
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sfu00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Sfum_2090
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Sfum_2090
Enzymes [BR:sfu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Sfum_2090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2555298..2556215
Genome map
AA seq 305 aa AA seqDB search
MPFKRKDLLGLRELDVHEIEHILELAVSLKEINARPIKKVPTLRGKTVIHLFYEPSTRTR
TSFDIAAKRLSADTYSITTAASSMVKGETLLDTVKNLEAMKPDVFVLRHTVSGTPHRIAR
HTTASVINAGDGMHEHPSQALLDMMTMLEHKKKLDGLTVAILGDIAHSRVARSNIWGLRK
MGAKVILCGPITLIPPEAHTMGVEVSHKLGEIIPEADVIMVLRLQKERQQQMLLPSLREY
SIYYGLTAEKLKKARRNVLIMHPGPLNRGVEISPDVADGPHSVILDQVTNGVAVRMALLY
LLGQK
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgccgtttaagagaaaagacttgctcggactccgcgaactggacgtccatgaaatcgag
cacatcctggagttggccgtttccctcaaagaaatcaatgcaagaccgatcaagaaggtg
cccactctcaggggaaagaccgtcattcatcttttctacgaaccgagcacgcgaacgcgg
acatccttcgatatcgccgcaaagcggctcagcgcggacacctattccatcaccacggca
gcgagctcgatggtcaagggagagacgctcctcgataccgtcaagaacctcgaagcgatg
aagccggacgtcttcgtccttcgccacaccgtgtcgggaacgccccatcgcattgcgcgg
catacgacggcgtcggtcatcaacgcgggggacggcatgcacgagcatccgtctcaagcc
ctgctggacatgatgaccatgctcgagcacaagaagaagctcgacgggctgacggtggcc
atcctcggggacatcgcccacagccgcgtggcgcgttccaacatctggggtttgaggaag
atgggcgcgaaggtcatcctctgcggcccgatcacgctcataccgcccgaagctcacacg
atgggcgtcgaggtgagccacaaactgggtgaaatcattccggaagcagacgtgatcatg
gtgctccgccttcagaaggaacgacaacagcagatgcttctgccctcgctgcgcgagtat
tccatctactacgggttgacggccgagaaactgaagaaggcccggcgcaacgttctcatc
atgcacccgggcccgctgaacaggggtgtggagatcagcccggacgtcgccgacgggccg
cattcggtcattctcgaccaggtgaccaacggagtcgccgtgcgcatggccttgctctac
ctgttgggccagaaatga

DBGET integrated database retrieval system