KEGG   Syntrophobacter fumaroxidans: Sfum_2090Help
Entry
Sfum_2090         CDS       T00418                                 

Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
sfu  Syntrophobacter fumaroxidans
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:sfu00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:sfu00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2555298..2556215
Genome map
AA seq 305 aa AA seqDB search
MPFKRKDLLGLRELDVHEIEHILELAVSLKEINARPIKKVPTLRGKTVIHLFYEPSTRTR
TSFDIAAKRLSADTYSITTAASSMVKGETLLDTVKNLEAMKPDVFVLRHTVSGTPHRIAR
HTTASVINAGDGMHEHPSQALLDMMTMLEHKKKLDGLTVAILGDIAHSRVARSNIWGLRK
MGAKVILCGPITLIPPEAHTMGVEVSHKLGEIIPEADVIMVLRLQKERQQQMLLPSLREY
SIYYGLTAEKLKKARRNVLIMHPGPLNRGVEISPDVADGPHSVILDQVTNGVAVRMALLY
LLGQK
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgccgtttaagagaaaagacttgctcggactccgcgaactggacgtccatgaaatcgag
cacatcctggagttggccgtttccctcaaagaaatcaatgcaagaccgatcaagaaggtg
cccactctcaggggaaagaccgtcattcatcttttctacgaaccgagcacgcgaacgcgg
acatccttcgatatcgccgcaaagcggctcagcgcggacacctattccatcaccacggca
gcgagctcgatggtcaagggagagacgctcctcgataccgtcaagaacctcgaagcgatg
aagccggacgtcttcgtccttcgccacaccgtgtcgggaacgccccatcgcattgcgcgg
catacgacggcgtcggtcatcaacgcgggggacggcatgcacgagcatccgtctcaagcc
ctgctggacatgatgaccatgctcgagcacaagaagaagctcgacgggctgacggtggcc
atcctcggggacatcgcccacagccgcgtggcgcgttccaacatctggggtttgaggaag
atgggcgcgaaggtcatcctctgcggcccgatcacgctcataccgcccgaagctcacacg
atgggcgtcgaggtgagccacaaactgggtgaaatcattccggaagcagacgtgatcatg
gtgctccgccttcagaaggaacgacaacagcagatgcttctgccctcgctgcgcgagtat
tccatctactacgggttgacggccgagaaactgaagaaggcccggcgcaacgttctcatc
atgcacccgggcccgctgaacaggggtgtggagatcagcccggacgtcgccgacgggccg
cattcggtcattctcgaccaggtgaccaacggagtcgccgtgcgcatggccttgctctac
ctgttgggccagaaatga

DBGET integrated database retrieval system