KEGG   Syntrophobacter fumaroxidans: Sfum_2265Help
Entry
Sfum_2265         CDS       T00418                                 

Definition
dTDP-4-dehydrorhamnose 3,5-epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
sfu  Syntrophobacter fumaroxidans
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:sfu00523]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:sfu00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2788338..2788892)
Genome map
AA seq 184 aa AA seqDB search
MMRIVHGDLPGLLVLEPRVFGDSRGFFFESYNQNTLRQWGIVLPFVQDNHSGSRKGVLRG
LHYQVGHAQGKLIRVVAGEVFDVAVDLRTKSPAFGRWFGMILSAAERKQIYIPPGFAHGF
LTVSDWAEVLYKTTDFYAPECERCIIWNDPDIGIDWPLECPPTLSSKDSEGLPLSKADRY
EDLF
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgatgcgtatcgtacatggcgacctgcccggactgcttgttttggagcccagagtattc
ggggattcgaggggattcttcttcgagagttacaatcagaatacgctcaggcaatggggc
attgtcctgccgtttgtccaggacaaccactccggttcccggaagggtgttttgcggggg
ctgcattaccaggtgggacacgcgcaggggaagctcatccgggtcgtcgccggcgaagtg
ttcgatgtcgcggtggacctcaggacgaaatcgccggcgttcggtcgctggttcggcatg
atactcagtgcggccgaacggaagcagatctacataccgccgggtttcgcgcacggattt
ctgacggtttccgattgggccgaagtgctttacaagacgacggacttttatgcaccggag
tgcgagcgctgcatcatctggaatgaccccgacattgggatcgattggccccttgagtgt
ccccccacgctctcctcgaaggattccgaagggttgcctctgtccaaagccgatcgatat
gaagatctcttctga

DBGET integrated database retrieval system