KEGG   Syntrophobacter fumaroxidans: Sfum_2404Help
Entry
Sfum_2404         CDS       T00418                                 

Definition
(GenBank) pyridoxal-phosphate dependent TrpB-like enzyme (EC:4.2.1.20)
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
sfu  Syntrophobacter fumaroxidans
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sfu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Sfum_2404
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sfum_2404
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Sfum_2404
Enzymes [BR:sfu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Sfum_2404
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2969421..2970782
Genome map
AA seq 453 aa AA seqDB search
MEQVKVILADNEIPRQWYNILPDMPTPMHPPLHPGTGKPVEPQDLAAVFPMNLIEQEVST
QSWIDIPEAVLEKYLLWRPTPLCRARNFEKLLDAPVKIYYKNEGVSAPGSHKPNTAIPQA
YYNKVFGIRRISTETGAGQWGSALSMACRMFGLQCRVFMVRISYDQKPYRRMMMSTWGAE
CIPSPSDFTRAGRRILSDDPESPGSLGIAISEAIEDAVGDENARYSLGSVLNHVLLHQTI
IGLEAHRQFEKIGEYPDVVMGCAGGGSNFAGLSLPFVRDKIHGREVSIIAAEPASCPTLT
RGPFAYDFGDTAMTTPLLPMYTLGHGFIPASIHAGGLRYHGMAPIVSHLVKEGIVQAQAY
DQIETFTAGLKWAQSEGFIPAPETNHVIAAVVREAELARQEGKEKVILFNWSGHGIIDLP
AYDAFLSGKLTQHALTDEEIREALKSIEGYPKP
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atggaacaggtgaaggtgattctggccgacaacgaaatccccaggcaatggtacaacata
ctccccgatatgccgactccgatgcatccgccgctgcatccgggaacgggaaaaccggtg
gaaccgcaggacctggccgctgtctttcccatgaacctgatcgagcaggaggtttccacc
caaagttggatcgatattcccgaagcggtcctggaaaagtatctcctgtggcgacccact
ccgctctgtcgtgcccgcaatttcgagaagctgctcgacgctccggtgaagatctactac
aagaacgaaggggtgagcgcgcccggctcccacaaacccaacacggccattccgcaagct
tactacaacaaggtgttcggcatccggcggatttccaccgagaccggggccgggcagtgg
ggcagtgccctcagcatggcgtgccggatgttcggcctgcaatgcagggtcttcatggtc
aggatcagctacgaccagaaaccgtaccggcgcatgatgatgtccacgtggggggccgag
tgcattccaagccccagcgacttcacgcgtgcggggaggagaatcctgtccgacgatccc
gagtcgccggggagcctgggcatcgccatcagcgaagccatcgaggacgccgtcggggac
gaaaacgcccggtactccctgggaagcgttttgaatcacgtgctgctgcaccagaccatc
atcggcctggaagcccaccgacagttcgaaaagatcggcgaataccccgacgtggtgatg
ggctgtgcgggaggaggaagcaacttcgccggactgtccctgcccttcgttcgggacaag
attcatggcagggaggtttccatcatcgccgcggagcccgcgtcctgcccgaccctgacg
cgcggaccgttcgcctacgatttcggcgacaccgccatgacgacgccgctcctgcccatg
tataccctggggcacggcttcataccggcctccatccacgccggcgggctccggtaccac
ggcatggccccgatcgtcagccacctggtcaaggaaggaatcgtccaggcccaggcctac
gaccagatcgaaaccttcaccgccggcctgaaatgggcccagtccgaggggttcattccc
gctcccgaaaccaaccacgtcatcgcggcggtggtccgtgaagcggagctcgcccggcag
gaaggcaaggagaaggtcatcctcttcaactggagcggccacgggatcatcgatcttccg
gcctatgacgctttcctctccgggaagctcacccagcacgcgttgaccgacgaggagatc
cgggaagccctgaaatccatcgaaggatatccaaaaccgtag

DBGET integrated database retrieval system