KEGG   Syntrophobacter fumaroxidans: Sfum_2646Help
Entry
Sfum_2646         CDS       T00418                                 

Definition
(GenBank) catalytic domain of components of various dehydrogenase complexes
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sfu  Syntrophobacter fumaroxidans
Pathway
sfu00010  Glycolysis / Gluconeogenesis
sfu00020  Citrate cycle (TCA cycle)
sfu00620  Pyruvate metabolism
sfu01100  Metabolic pathways
sfu01110  Biosynthesis of secondary metabolites
sfu01120  Microbial metabolism in diverse environments
sfu01130  Biosynthesis of antibiotics
sfu01200  Carbon metabolism
Module
sfu_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sfu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sfum_2646
   00020 Citrate cycle (TCA cycle)
    Sfum_2646
   00620 Pyruvate metabolism
    Sfum_2646
Enzymes [BR:sfu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Sfum_2646
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N HlyD_3 GCV_H HlyD_D23 NQRA
Motif
Other DBs
NCBI-ProteinID: ABK18324
JGI: Sfum2646
UniProt: A0LLM2
Position
complement(3273743..3275074)
Genome map
AA seq 443 aa AA seqDB search
MSVEFRLPDLGEGIHEGEIVEVLVSVGDRVLDGQPVMVIETDKATTEVPAPVSGVVKEIR
VKPGEVVKVGAVLMTFEAEGRAVAAAPPEKDVSREKAGGLEAPPGGGETRPAVTASKEPP
AAAPSTRRLARELGIDLRQVAPSGPGGRVTPEDVRRHAELQGRKPAAPSPQAAVAEEEAP
VARTAAPEAAPAPSPAGEPLGACDPHGAIERVPLRSVRRATAKHLARAWAEIPHVSHQDV
ADITELDAFRRKHKAEIREAGGALNMIVFVLKAAVAALKAFPGFNASIDPEREEIVFKRY
YNIGVAVDTDRGLIVPVIRDVDRKSVRELAVELLDVAERTRRGKAEREEMTGGTFTLTNI
GALGGTAFTPIINHPQSAILGMGQARLQPVVRGDLERHEIVPRLLLPLIVAFDHRIVDGA
DAARFLGMIIEALENPEELLLVI
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgtccgtggaattcaggctcccggacctgggggaaggcattcatgagggcgagatcgtc
gaggtcctggtctccgtgggggacagggtcctggacggccagccggtcatggtgatcgag
acggacaaggccaccacggaagtgccggccccggtctcgggcgtggtgaaggaaatccgt
gtgaaaccgggcgaggtggtcaaggtgggagcggtgctcatgaccttcgaagcggaaggc
cgggcggtcgcggccgcgcctcccgaaaaggacgtttcgcgcgagaaggcgggcggtttg
gaggctccccccggcgggggagagacccggccggccgtaacggcttccaaagaaccgccg
gcggcggcgccgtccacgcggcggctggcccgcgaactcggaatcgacttgcgccaggtg
gcgcccagcggccccggaggacgggtgactcccgaagacgtgcgccggcatgccgagctc
cagggtcgcaaaccggcggccccgtcgcctcaggccgccgtggccgaggaagaggctccg
gttgcccggaccgccgcccccgaagccgcccctgcgccttcccccgcgggagagccgctc
ggagcctgcgatccacacggcgccatcgagcgtgttccgctgcgttcggtgaggcgggcc
acggcgaaacatcttgcccgggcgtgggcggagattccgcacgtgtcccaccaggacgtt
gccgacatcaccgagctcgatgccttccgccgaaaacacaaggcggaaatccgcgaagcg
ggcggagccctcaacatgatcgtattcgtgctcaaagccgccgtcgccgcgctcaaagcc
tttcccggcttcaacgcgagcatcgatccggaacgggaggaaatcgtcttcaagcgttac
tacaacatcggcgtggccgtggacacggaccgggggctcatcgtgccggtgatccgggat
gtcgaccggaaaagcgtccgggagctggccgtggagctcctcgacgtggcggagcggacc
cgtcggggtaaggcggagcgcgaggagatgaccgggggcaccttcaccctgacgaacatc
ggcgctctcggcgggacggctttcactcccatcatcaaccatccccagtcggcgatcctc
ggaatgggacaggcgaggctgcagccggtggtgcgcggcgacctggaacgccatgagatt
gtgccgaggctgctgctgcccctgatcgtcgctttcgatcaccggatcgtggacggcgcg
gacgccgcgcgtttcctggggatgatcatcgaggcgctggagaaccccgaagaactgttg
ctggtgatctag

DBGET integrated database retrieval system