KEGG   Syntrophobacter fumaroxidans: Sfum_2791Help
Entry
Sfum_2791         CDS       T00418                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
sfu  Syntrophobacter fumaroxidans
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:sfu03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3441173..3441778
Genome map
AA seq 201 aa AA seqDB search
MVSSGYPPIMNDLIRRLSKLPGLGEKSATRIAMHLLKMSRTDAESLADAIRELRSRIRTC
SRCFHFTDAEECSICADPARDTGEICVVETTADLLAIEQSGAYRGRYHVLQGVLAPLDAV
GPDDLRIRELLERIDREGAREVIIATNPSSEGEATAHYLLKLLKDRNVRVSRIAYGIPMG
GDLKYTDRFTLERALKGRQAF
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atggtttcgagcggctacccccccattatgaacgacctcatcaggaggctgagcaagctg
ccgggattgggagaaaagagcgccacccggatcgccatgcatctgctcaaaatgtcgagg
accgatgccgaaagcctggcggacgcgatccgggagctgagaagtcggatccggacgtgt
tcccggtgttttcacttcacggatgccgaggagtgttccatttgtgcggatcctgcccgg
gacaccggggagatctgcgtggtggaaaccaccgcggacctgctggcgatcgaacagtcc
ggggcataccggggacgctaccatgtcctgcagggcgtgcttgcgccgctggacgcggtg
gggcccgacgacctgcgtatccgggagctgctcgagcgcatcgatcgggagggtgcgcgg
gaagtgatcatcgccacgaaccctagcagtgaaggggaagcgaccgcgcattacctgctg
aaactcctgaaggatcgcaacgtgcgggtatcccggattgcctacggcattcccatgggg
ggcgacctcaagtacaccgaccggttcaccctggaacgggctctgaaggggcggcaggcg
ttctga

DBGET integrated database retrieval system