KEGG   Syntrophobacter fumaroxidans: Sfum_2791Help
Entry
Sfum_2791         CDS       T00418                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
sfu  Syntrophobacter fumaroxidans
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:sfu00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Sfum_2791
DNA repair and recombination proteins [BR:sfu03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Sfum_2791
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3441173..3441778
Genome map
AA seq 201 aa AA seqDB search
MVSSGYPPIMNDLIRRLSKLPGLGEKSATRIAMHLLKMSRTDAESLADAIRELRSRIRTC
SRCFHFTDAEECSICADPARDTGEICVVETTADLLAIEQSGAYRGRYHVLQGVLAPLDAV
GPDDLRIRELLERIDREGAREVIIATNPSSEGEATAHYLLKLLKDRNVRVSRIAYGIPMG
GDLKYTDRFTLERALKGRQAF
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atggtttcgagcggctacccccccattatgaacgacctcatcaggaggctgagcaagctg
ccgggattgggagaaaagagcgccacccggatcgccatgcatctgctcaaaatgtcgagg
accgatgccgaaagcctggcggacgcgatccgggagctgagaagtcggatccggacgtgt
tcccggtgttttcacttcacggatgccgaggagtgttccatttgtgcggatcctgcccgg
gacaccggggagatctgcgtggtggaaaccaccgcggacctgctggcgatcgaacagtcc
ggggcataccggggacgctaccatgtcctgcagggcgtgcttgcgccgctggacgcggtg
gggcccgacgacctgcgtatccgggagctgctcgagcgcatcgatcgggagggtgcgcgg
gaagtgatcatcgccacgaaccctagcagtgaaggggaagcgaccgcgcattacctgctg
aaactcctgaaggatcgcaacgtgcgggtatcccggattgcctacggcattcccatgggg
ggcgacctcaagtacaccgaccggttcaccctggaacgggctctgaaggggcggcaggcg
ttctga

DBGET integrated database retrieval system