KEGG   Syntrophobacter fumaroxidans: Sfum_2864Help
Entry
Sfum_2864         CDS       T00418                                 

Definition
protein-L-isoaspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
sfu  Syntrophobacter fumaroxidans
Brite
Enzymes [BR:sfu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Sfum_2864
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3533549..3534292
Genome map
AA seq 247 aa AA seqDB search
MSRKSTGAFLVILLLSMAAGGAVGAADDPYGAARAKMVREIEEDARRTSERIGKTALDPR
VMEIMARVPRHEFVPAAERAYAYENRPLPIGYGQTISQPYIVAVMTDLLKVGSESTVLEV
GTGSGYQAAILAEFVRSVYSIEIIEALAETAAERLKRLGYDNVRVRTGDGYHGWKEHAPF
DGIVVTAAAGHIPPPLLDQLKPGGRMIIPVGGPFFVQQLMLVEKDEQGRTRTRQILPVAF
VPLTGGH
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgagccgaaaatcgacaggcgcattcctcgtgatccttttgctgtccatggctgcaggc
ggggcggtcggggccgcggacgatccctacggcgcggcccgcgcgaaaatggtccgggag
atcgaggaggacgcccgccggaccagcgagcgtatcggcaagacggcgctcgatccccga
gtcatggagatcatggcccgagttccccggcatgaattcgttcccgcggccgagcgggct
tacgcctacgaaaaccgtccccttcccatcggctacgggcagaccatctcgcagccttac
atcgtggccgtcatgaccgaccttctcaaggtcgggagcgagagcacggtgctcgaggtc
ggaacgggatcgggataccaggcggccattctggccgaattcgtgcggagcgtctactcc
atcgagatcatcgaggcactggccgaaaccgccgcggagcggctcaagcggctggggtac
gacaacgtgcgggtcaggaccggcgacggctaccatggatggaaagagcacgcccccttt
gacgggatcgtcgtcacggccgccgccggtcacatcccgccgcctctcctcgatcagctc
aaaccgggggggagaatgatcatccccgtcggcggccccttcttcgtgcagcagttgatg
ctcgtggaaaaggacgagcaggggcggacccggacgcgtcagatccttcccgtggctttc
gtccctttgaccggcgggcactga

DBGET integrated database retrieval system