KEGG   Syntrophobacter fumaroxidans: Sfum_2958Help
Entry
Sfum_2958         CDS       T00418                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
sfu  Syntrophobacter fumaroxidans
Pathway
sfu00010  Glycolysis / Gluconeogenesis
sfu00030  Pentose phosphate pathway
sfu00051  Fructose and mannose metabolism
sfu00052  Galactose metabolism
sfu00680  Methane metabolism
sfu01100  Metabolic pathways
sfu01110  Biosynthesis of secondary metabolites
sfu01120  Microbial metabolism in diverse environments
sfu01130  Biosynthesis of antibiotics
sfu01200  Carbon metabolism
sfu01230  Biosynthesis of amino acids
sfu03018  RNA degradation
Module
sfu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:sfu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sfum_2958
   00030 Pentose phosphate pathway
    Sfum_2958
   00051 Fructose and mannose metabolism
    Sfum_2958
   00052 Galactose metabolism
    Sfum_2958
  Energy metabolism
   00680 Methane metabolism
    Sfum_2958
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Sfum_2958
Enzymes [BR:sfu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Sfum_2958
Protein phosphatases and associated proteins [BR:sfu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Sfum_2958
Messenger RNA biogenesis [BR:sfu03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Sfum_2958
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DAGK_cat
Motif
Other DBs
NCBI-ProteinID: ABK18632
JGI: Sfum2958
UniProt: A0LMI0
Position
complement(3654088..3655377)
Genome map
AA seq 429 aa AA seqDB search
MNEAELNFEVARLGACRIPSPMGSIQFVEDDEHVLYHTSLKEIKACECAGREPPGFEIAG
PRREIFFDPSKLKCGIVTCGGLCPGLNDVIRSIVLSLHHHYGVQTVFGFPYGFEGLTYRY
GHRPLELSPETVRDIHMKGGTILGSSRGPQDVLEMVDTLDRMNIGILFTIGGDGTLKGAL
AISEEIAKRNLKIAVVGIPKTIDNDISYMDRSFGFTTAVSEARTSIYAASTEALGARNGI
GLVKLMGRESGFIAAYATLATSEVNFCLVPEVHFTLEGFMETLRERILKRRHAVIVVAEG
AGQELMAETSGTDASGNVRFGDIGTFLRDRIKEYFGKAGMELNLKYIDPSYTIRSKSATT
QDSVFCLLLGHNAVHAAMSGRTGMVVGFWNEEFTHVPIRLAVSKRKRIDPNGKLWDYVLA
ATGQPRNMA
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaggcagaactcaatttcgaagtggcaagactcggcgcatgccgtattccttct
cccatggggagcatacaattcgtcgaggatgacgaacacgtgctttaccacaccagcctg
aaggaaataaaggcgtgcgaatgcgcgggcagggaacctcccggctttgaaattgccggt
ccgaggcgcgaaatatttttcgacccctcgaagttgaaatgcggcatcgtgacctgtgga
ggtctctgcccggggctcaacgacgtcatccgatccatcgtcctcagcctgcaccatcat
tacggagtgcagacggtcttcggattcccgtacgggttcgaagggctgacctaccggtac
ggccaccgtccgctcgagctttcaccggagacggtccgggacattcacatgaagggcggg
acgatcctgggttcctcgcgcggtccccaggatgtcctggaaatggtggatactcttgac
cggatgaacattggaatcctcttcaccatcgggggagacggtacattgaagggcgctctg
gccatctccgaggaaattgcgaagaggaatctcaagatcgcggtagtgggcatccccaag
accatagacaacgacatttcctacatggaccgctcattcggtttcaccacggcggtttcg
gaagcccggacgtccatctatgcggcgagcacggaggcactcggggctcgaaacggaatc
gggctggtgaagctgatgggacgggaatccggcttcatcgcagcttatgccaccctggcc
acgagcgaagtgaatttctgcctggtccccgaagtgcatttcacgctggaaggattcatg
gaaacgctccgggagagaatcctgaagcgaaggcacgcggtcatcgtcgtggcggagggg
gccggccaggaactcatggccgaaacctccgggacggacgcatccggcaacgttcgcttc
ggggacatcggcacctttttgcgggacaggatcaaggaatatttcggaaaagccgggatg
gagctcaacctgaaatacatcgacccgagctacaccattcggagcaagtcggcaaccact
caggattccgtgttttgcctgctgctcggccacaacgccgttcatgcggccatgagcggt
cgcaccggcatggtggtgggtttctggaatgaggagttcacgcacgtccccatccgtctg
gccgtttcgaaacgcaaacgcatcgaccccaacggaaagctctgggattacgttctggct
gcgacgggccagccacggaacatggcctga

DBGET integrated database retrieval system