KEGG   Syntrophobacter fumaroxidans: Sfum_2958Help
Entry
Sfum_2958         CDS       T00418                                 

Definition
diphosphate--fructose-6-phosphate 1-phosphotransferase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
sfu  Syntrophobacter fumaroxidans
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:sfu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sfum_2958
   01230 Biosynthesis of amino acids
    Sfum_2958
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sfum_2958
   00030 Pentose phosphate pathway
    Sfum_2958
   00051 Fructose and mannose metabolism
    Sfum_2958
   00052 Galactose metabolism
    Sfum_2958
  Energy metabolism
   00680 Methane metabolism
    Sfum_2958
Enzymes [BR:sfu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Sfum_2958
Protein phosphatases and associated proteins [BR:sfu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Sfum_2958
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3654088..3655377)
Genome map
AA seq 429 aa AA seqDB search
MNEAELNFEVARLGACRIPSPMGSIQFVEDDEHVLYHTSLKEIKACECAGREPPGFEIAG
PRREIFFDPSKLKCGIVTCGGLCPGLNDVIRSIVLSLHHHYGVQTVFGFPYGFEGLTYRY
GHRPLELSPETVRDIHMKGGTILGSSRGPQDVLEMVDTLDRMNIGILFTIGGDGTLKGAL
AISEEIAKRNLKIAVVGIPKTIDNDISYMDRSFGFTTAVSEARTSIYAASTEALGARNGI
GLVKLMGRESGFIAAYATLATSEVNFCLVPEVHFTLEGFMETLRERILKRRHAVIVVAEG
AGQELMAETSGTDASGNVRFGDIGTFLRDRIKEYFGKAGMELNLKYIDPSYTIRSKSATT
QDSVFCLLLGHNAVHAAMSGRTGMVVGFWNEEFTHVPIRLAVSKRKRIDPNGKLWDYVLA
ATGQPRNMA
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaggcagaactcaatttcgaagtggcaagactcggcgcatgccgtattccttct
cccatggggagcatacaattcgtcgaggatgacgaacacgtgctttaccacaccagcctg
aaggaaataaaggcgtgcgaatgcgcgggcagggaacctcccggctttgaaattgccggt
ccgaggcgcgaaatatttttcgacccctcgaagttgaaatgcggcatcgtgacctgtgga
ggtctctgcccggggctcaacgacgtcatccgatccatcgtcctcagcctgcaccatcat
tacggagtgcagacggtcttcggattcccgtacgggttcgaagggctgacctaccggtac
ggccaccgtccgctcgagctttcaccggagacggtccgggacattcacatgaagggcggg
acgatcctgggttcctcgcgcggtccccaggatgtcctggaaatggtggatactcttgac
cggatgaacattggaatcctcttcaccatcgggggagacggtacattgaagggcgctctg
gccatctccgaggaaattgcgaagaggaatctcaagatcgcggtagtgggcatccccaag
accatagacaacgacatttcctacatggaccgctcattcggtttcaccacggcggtttcg
gaagcccggacgtccatctatgcggcgagcacggaggcactcggggctcgaaacggaatc
gggctggtgaagctgatgggacgggaatccggcttcatcgcagcttatgccaccctggcc
acgagcgaagtgaatttctgcctggtccccgaagtgcatttcacgctggaaggattcatg
gaaacgctccgggagagaatcctgaagcgaaggcacgcggtcatcgtcgtggcggagggg
gccggccaggaactcatggccgaaacctccgggacggacgcatccggcaacgttcgcttc
ggggacatcggcacctttttgcgggacaggatcaaggaatatttcggaaaagccgggatg
gagctcaacctgaaatacatcgacccgagctacaccattcggagcaagtcggcaaccact
caggattccgtgttttgcctgctgctcggccacaacgccgttcatgcggccatgagcggt
cgcaccggcatggtggtgggtttctggaatgaggagttcacgcacgtccccatccgtctg
gccgtttcgaaacgcaaacgcatcgaccccaacggaaagctctgggattacgttctggct
gcgacgggccagccacggaacatggcctga

DBGET integrated database retrieval system