KEGG   Syntrophobacter fumaroxidans: Sfum_3201Help
Entry
Sfum_3201         CDS       T00418                                 

Definition
(GenBank) uroporphyrinogen-III synthase / uroporphyrinogen-III C-methyltransferase
  KO
K13542  uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
sfu  Syntrophobacter fumaroxidans
Pathway
sfu00860  Porphyrin and chlorophyll metabolism
sfu01100  Metabolic pathways
sfu01110  Biosynthesis of secondary metabolites
sfu01120  Microbial metabolism in diverse environments
Module
sfu_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:sfu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Sfum_3201
Enzymes [BR:sfu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     Sfum_3201
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Sfum_3201
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 TP_methylase
Motif
Other DBs
NCBI-ProteinID: ABK18874
JGI: Sfum3201
UniProt: A0LN72
Position
complement(3924389..3925948)
Genome map
AA seq 519 aa AA seqDB search
MSKGKAYLVGAGPGDPGLLTLRGREVLEKAEVVIYDYLANEEFLKYAPPDAEKIYVGKKG
GDHTLSQDGINALLVAKARDRVVVRLKGGDPFVFGRGGEEAQVLVEAGIPFEVVPGVTAA
VSVPAYAGIPLSHRDHTASMAFVTGHEREDKGDSKIAWDKLATGVGTLVFFMGVKNLPEI
CRSLIAHGRPARTPVAVIRWGTTPDQQTVTGTLENIVERVREAQLKPPAITVVGDVVNLR
GELNWFENRPLFGRRIVVTRAREQASDFKGMLTELGAHCIEFPTIAIEPPPSWRELDEAI
RRLASYDWAIFTSVNGVRFFMERLRALGLDVRELKGVRLAAIGPKTAEALEKTGLRVDLV
PSEYRAESILDSLGDADLRERRFLIPRAMVARDILPETLRAKGALVEVVPAYRTVIPRER
GPEIAERFRKAEIHCLTFTSSSTVSNFFSLFDRGEILPLLEGVAIACIGPVTAQTAVKHG
LKVHIMPAEYTIPGLANAICSHFEAKRPEKPVPGEDPVD
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
gtgtccaaaggcaaagcctacctggttggagcgggtcccggcgatcccgggctgttgacc
cttcgcggccgtgaagtcctggagaaagccgaagtggtcatctatgactaccttgcgaac
gaggagttcctgaaatacgctccccccgatgccgagaagatctatgtgggcaagaaaggc
ggcgaccataccctgagccaggacggcatcaatgcgctgctggtcgccaaggcgcgcgac
cgggtggtggtccgcctcaaaggcggagaccccttcgtgttcggacgtggtggagaggaa
gctcaagtcctggtcgaggcgggtatcccgttcgaggtggtgcccggcgtaacggccgcc
gtctcggtgccggcctatgcgggcatccccctttcccatcgagaccacacggcgagcatg
gccttcgtcaccggccatgaacgggaggacaaaggcgattccaaaatcgcctgggacaag
cttgccaccggtgtcggcaccctggtgtttttcatgggcgtgaagaacttgccggaaatc
tgccgaagtctgatcgcgcacggcagaccggcacggacgccggtggccgtcattcgctgg
ggaacgacacccgaccagcagacggtgaccggaacactcgaaaacattgtggaaagggtc
cgggaagctcagctcaaaccgccggcgatcaccgtcgtgggcgacgtggtgaatctgcgc
ggcgagctgaactggttcgagaatcgtccactgttcggcaggcgcatcgtggtgacccgt
gcacgcgaacaggcgagcgatttcaaaggcatgttgaccgaactgggcgcacactgtatc
gagtttccgaccatcgccatcgaaccgcctccatcctggcgggagctcgatgaagccatc
cggcggctggcatcctatgactgggcgattttcaccagcgtgaacggcgtccggtttttc
atggaaaggctgcgggcactggggctggacgttcgcgaactgaagggtgtccgtctggcg
gccatcggcccgaagacggctgaagctctggagaaaacgggcctgagagtcgatctcgtg
ccctcggaataccgtgcggaatccattctcgattcgctcggcgacgcggacttgcgagag
cgtcgctttctgatcccgcgggctatggtcgcccgggatatccttccggaaacgctccgt
gccaaaggcgctttggtcgaggtggtgccggcctatcggaccgtcatcccgagggagcgc
ggcccggaaattgccgaacgcttccggaaggccgaaattcattgcctcaccttcacctcc
tcgtccaccgtctccaatttcttcagtctctttgaccggggcgagattctgccgctcctc
gaaggggtcgcaatcgcctgcatcggaccggtcaccgcgcagaccgccgtgaaacacggc
ctgaaagtccacatcatgcccgccgaatacaccattccagggctggcgaacgccatttgc
tcgcatttcgaggcaaagagaccggaaaagccggtcccgggcgaagacccggttgactga

DBGET integrated database retrieval system