KEGG   Syntrophobacter fumaroxidans: Sfum_3414Help
Entry
Sfum_3414         CDS       T00418                                 

Definition
(GenBank) peptidase M42 family protein
Organism
sfu  Syntrophobacter fumaroxidans
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(4179355..4180455)
Genome map
AA seq 366 aa AA seqDB search
MLNDPVTAAAIHLLKSLAEAPGAPGHEDAVRRIFRTEVGGDTTTDKTGSIIYTKKGTSET
PRIMLAAHMDEVGFVVQSVTREGLIRFLPLGGWWPHTILAKRVRIITRNNTEIIGVVGAK
PPHFLTDAEREKVMKIEDMFIDVGARDAVDVRDRFGIEVGDSIVPDSSFTVLHDPDVFLC
KAFDNRVGMAVVIHAAAMLMSMTHHNTVCAVGTVQEEVGVRGAQTAAHAVNPDAAIILEG
TPADDLPGTTEEERQGKLRGGVQIRLMDPSAIMNRKFSRYAVELAREHGIAHQVAVRRSG
STDARAVHLTREGVPTIVLGVPSRYIHTHNGLVHMEDYLSALDLVMKLLERLDEDAVRSF
VTYDDK
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgctgaacgatcctgtaacagccgccgcaattcacttgctgaagagcctcgccgaagct
cccggcgcgccgggtcatgaagacgccgtgcgccgtatcttccggacggaagtggggggg
gacaccaccacggacaaaaccgggagcatcatttacacgaaaaaaggaacttccgaaacc
cctcggatcatgcttgccgcgcacatggatgaagtcgggttcgtggtgcagagcgtcacg
cgggaaggactgatccggttcctcccgttgggcggctggtggccgcatacgatcctggcc
aaacgggtgaggataatcacccgcaacaacacggagatcatcggcgtcgtgggggccaag
ccaccccatttcctgaccgacgccgaacgtgaaaaagtgatgaaaatcgaagatatgttc
atcgatgtgggagcgcgcgacgcggtggatgtccgggatcgtttcgggatcgaggtggga
gacagcatcgttcccgacagcagcttcaccgtgctgcacgatcccgacgtcttcctgtgc
aaggcgttcgacaaccgggtggggatggccgtggtcatacatgccgccgccatgctgatg
tcgatgacgcaccacaacacggtttgcgcggtgggaacggtccaggaggaagtcggggtg
aggggcgcccagaccgcggcgcacgccgtcaatcccgacgcggccatcatcctggaaggc
acgccggcggacgatctgccaggaacgacggaagaggagcgacagggaaaactgcgggga
ggcgtccagatcaggctcatggacccgtcggcgatcatgaatcgcaagttcagccgatat
gccgtcgaactggcccgagaacacggaatcgcgcaccaggtcgcagtccgccgaagcgga
tcgaccgacgcccgtgccgttcatctgacgcgggaaggcgtgccgaccatcgttctcggc
gtaccctcccgttacatccatacccacaacgggctcgttcacatggaggactacctgagc
gcactcgacctggtcatgaaattgctcgaacggctcgacgaggatgccgttcggtcgttt
gttacctacgacgacaagtag

DBGET integrated database retrieval system