KEGG   Syntrophobacter fumaroxidans: Sfum_3451Help
Entry
Sfum_3451         CDS       T00418                                 

Definition
glycogen branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
sfu  Syntrophobacter fumaroxidans
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:sfu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Sfum_3451
Enzymes [BR:sfu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Sfum_3451
Exosome [BR:sfu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Sfum_3451
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4214365..4216293
Genome map
AA seq 642 aa AA seqDB search
MSANGMRYDVSLLTDQDIYLFRQGNHFRLYEKMGAHLMEIDGVSGTLFAVWAPNAEQVSV
IGDFNGWNRGAHPLRVREDSSGIWEGFVAGVKAGDIYKYHIVSRENGYRVDKGDPFATHW
ETPPRTGSIVWDSSFAWNDGEWMENRKRSNALDAPCSIYEVHLGSWRRVPEQDNRSLNYR
EMAEDLPGYLRDMGFTHVEFLPVMEHPFYGSWGYQTVGYFAPTSRYGTPQDFMHLVQRLH
QAGIGVILDWVPSHFPSDEYGLVYFDGTYLFEHADPKKGYHPEWNSYIFNHGRYEVRSFL
ISSAMFWLDRYRVDGLRVDAVASMLYLDYARQDGEWIPNEHGGKENLDAIYFLRRFNEIV
YRDFPDCQTIAEESTSWPMVSRPSYAGGLGFGMKWNMGWMHDTLDYFSKESIHRKYHQNQ
LTFSIWYAFYENFVLPLSHDEVVYGKGSLLNKMPGDDWQKFANLRLLFGYMFGHPGKKLL
FMGGEFGQWDEWYHEKSLDWNLLEHPPHQGMQQWVRDLNRFYRGEPAMHEVDFENQGFQW
IDFRDADSSVLSWLRKGRSTKDIVVAAANFTPVPREGYLTGVPRGGFWREMLNSDSEIYG
GGGLGNAGGLEAAPVPCHGRPWSLSLVLPPLGVVFLKSEGTN
NT seq 1929 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccaacggcatgagatatgacgtcagtcttctgaccgatcaggacatctatctt
ttcaggcagggaaatcattttcggctgtatgagaaaatgggggcgcatctcatggagatc
gacggcgtttcgggcaccctgttcgccgtctgggcgcccaacgccgagcaggtttccgtc
attggagacttcaacggctggaaccgtggagctcatcccttgagggtgagggaggacagc
tcggggatatgggaggggttcgtcgccggagtgaaggccggagacatttacaagtaccat
attgtttcaagggaaaacggatatcgggtggacaagggggatccgttcgcgacccactgg
gaaaccccgccgcgcaccggttccatcgtgtgggacagcagttttgcgtggaacgacgga
gaatggatggaaaaccggaaacgcagcaatgcgctcgacgccccctgttcgatctacgag
gttcatctcggctcctggaggcgggttcccgagcaggacaacaggtccctcaactatcgc
gagatggcggaggatctgcccggatacttgcgtgacatgggattcacccacgtggaattc
ctgccggtcatggagcaccctttctacggatcctggggctaccagacggtggggtacttc
gcgccgacgtcgcgatacgggacgccccaggacttcatgcacctcgtccaacggctgcac
caggccgggatcggggtcattctggactgggtcccgtcgcattttcccagcgatgagtac
ggcctggtctatttcgacggcacctacctcttcgagcatgccgacccgaagaagggatat
catccggagtggaacagctacatattcaatcacggcaggtacgaggtccggtcgtttctg
atcagcagcgccatgttctggctggaccgctaccgggtggacggtctgcgcgtggatgcc
gtggcctcgatgctctacctggattacgcccggcaggatggggaatggatccccaacgag
cacgggggcaaggagaacctcgacgccatatacttcctcagacgattcaacgaaatcgtc
tacagggacttccccgactgccagacgatcgccgaagagtccacctcctggcccatggtt
tcccgaccttcctatgccggcgggctgggtttcgggatgaaatggaacatggggtggatg
cacgacaccctggactatttttccaaggagtccattcatcgcaaataccaccagaaccag
ctcacgttcagcatctggtacgcattctacgaaaacttcgtgcttcccctgtctcacgac
gaggtggtctacggcaaggggtccctgctgaacaagatgccgggagacgactggcagaaa
ttcgcaaatttgcggcttctgttcggctacatgttcgggcatcccggcaagaagctgctg
ttcatggggggggaattcggacagtgggacgaatggtaccatgaaaaaagcctcgactgg
aacctgctcgaacacccgcctcaccagggaatgcagcagtgggtccgggacttgaaccgc
ttctatcgcggcgaaccggcgatgcatgaggtggatttcgaaaatcaggggttccaatgg
atcgattttcgtgacgcggattcgagtgttttgtcctggctgcggaagggtcgtagcaca
aaagacatcgtcgtcgcggcggcgaatttcacgccggtgcccagggaaggctacctgacg
ggtgtgccccggggcggcttctggcgggagatgctcaacagcgattccgaaatatacggc
gggggaggtctcggcaacgcggggggactcgaagccgcgcctgttccgtgccacgggaga
ccctggtctctttcactggtcctgccgcccctgggcgtggtgttcctgaagagcgaaggc
acgaattga

DBGET integrated database retrieval system