KEGG   Syntrophobacter fumaroxidans: Sfum_3452Help
Entry
Sfum_3452         CDS       T00418                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
sfu  Syntrophobacter fumaroxidans
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sfu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Sfum_3452
Enzymes [BR:sfu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Sfum_3452
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4216385..4217947
Genome map
AA seq 520 aa AA seqDB search
MTPRSSGILLHLTSLPSDHGIGDMGRGAYDFVDFLSDSGQSIWQVLPIGPSSGFCGNSPY
CGFSVFAGNPLLIGLDLLVEDGLLTRGEIETRHPFASRLVDYEAVEPFKTALLRRAFEKY
RERAGADAEFQRFCAENADWLDDYALFTSIRERLSGAGWSDWPDALKNREEAALRKAGEE
LAESVLREKFCQYVFFTQWTSLKAYCKSKGGRIFGDIPIYVSHDSADVWANPEVFKLDAR
KRPAFVAGVPPDYFSKTGQLWGNPVYCWETLKDTDFSWWVKRMAWNLRLFDLARLDHFRG
FVAYWEVAAGEKTAQNGRWVDAPARALFDTLLRRFPRLPLVAEDLGTITPDVREIIRHYG
FPGMKILQFAFGGGGASNPYVPHNHVRNCIVYTGTHDNNTTRGWFAHDASAAEKKSLFRY
LGRTIEEDRAHEELIRLAMMSVCDAAIIPMQDHLGLGGDARMNLPAVAFGNWAWRLEAES
LTPALAASILEVTETYGRTPGEGMTDSDTQPSGTHSSETV
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgactccaagaagcagcgggatactccttcacctcacatcgcttccgtccgaccacggc
ataggagatatgggccggggcgcttacgatttcgtggattttctgagcgattccgggcaa
agcatctggcaggttctgcccatagggccgtcgtccgggttctgcgggaattccccgtat
tgcggtttttccgtctttgcggggaaccccttgctgatcggcctcgatctcctggtggag
gacggactcctcacccggggggagatcgaaacccggcacccgtttgcatcgcgcttggtg
gactacgaagccgtcgagcccttcaaaaccgcgctgcttcggcgcgccttcgaaaagtac
cgggaaagggccggagccgacgcggagtttcagcggttctgtgccgagaacgccgactgg
ctagatgactacgcattgttcaccagcatcagggaacggctttcgggggccggctggagc
gattggcccgacgctctgaagaacagggaggaggccgcgctgcgcaaggccggggaagaa
ctggcggagagcgttttgcgggagaaattctgccagtacgtgttcttcacgcagtggact
tctctgaaggcctactgcaagagcaagggggggcggattttcggcgacatcccgatctat
gtgagccacgacagcgcggacgtctgggcgaacccggaggttttcaagcttgacgcgcgg
aagagaccggcattcgtggccggcgttccgcccgactacttcagcaagaccgggcagctc
tgggggaatccggtctactgctgggaaaccctcaaggacacggatttcagttggtgggtg
aaacgcatggcgtggaacctgcgcctgttcgacctggccaggctggatcatttccggggc
ttcgtggcctactgggaagttgcggccggggagaagacggcgcagaacgggcgatgggtg
gacgctcccgcgcgcgcgttgttcgacacgcttttgcgccgattcccgaggttgccgctc
gtcgccgaggatctggggaccattacgcccgatgttcgggaaatcatccggcactacggt
tttcccggcatgaagatcctgcagttcgcgttcggaggaggcggagcctcaaatccttat
gtgcctcacaatcacgtcagaaattgcatcgtatacaccgggacgcacgacaacaacacg
accaggggatggttcgctcacgacgcatcggcggccgagaaaaagagcctcttccgatac
cttggccgcaccatcgaagaagaccgcgctcacgaggagctgatcaggcttgcgatgatg
tcggtgtgcgacgccgcgatcattcccatgcaggaccatctgggcctggggggggatgcc
cgcatgaatctgccggccgtggcttttggaaactgggcgtggcggctcgaggccgaaagc
ctgaccccggctctggcggcctccatcctggaagtcaccgaaacgtacgggcgaaccccc
ggggagggaatgaccgactccgatacgcagccgtccgggacccattcctccgaaaccgtg
tga

DBGET integrated database retrieval system