KEGG   Syntrophobacter fumaroxidans: Sfum_3466Help
Entry
Sfum_3466         CDS       T00418                                 

Definition
UDP-N-acetylmuramyl-tripeptide synthetases
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
sfu  Syntrophobacter fumaroxidans
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:sfu00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Sfum_3466
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Sfum_3466
Enzymes [BR:sfu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     Sfum_3466
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4232069..4233583
Genome map
AA seq 504 aa AA seqDB search
MARALNNLLRDVEILQTAGPLDVPVTGIAYDSRRIQAGNVFVALPGVRVDGNRFIPEAVR
SGASAVITETVGFSECPATVVRVSDSRKAMARMAANYYGHPCAGLKMIGVTGTNGKTTTT
LLLESILKRGGHSVGVLGTLFYRWGAKSKTAGMTTPESLDLQGLFYEMREDGVTHVVMEV
SSHALAQGRVAECAFDAAVFTNLSQDHLDYHVTMEDYFAAKSLLFSEYLRTGSVAVINGD
DPYGARLVEKAGPGAWSYSTGSEAARAHVKSARLTASGIEARLCGPDGSMDIHSPLIGRL
NLYNILAAVTASLAMGVPEAAIREGVAGLTSVDGRLQRVASPGTGFEVVVDYAHTPDAME
KSLGCLREMTAGRLLVVFGCGGDRDRGKRPLMGKVAGALGDLVIVTSDNPRSEVPERIID
EIEPGVRASGLERILAAEPGNGARGYIVEVDRKSAIEKALAWARPGDTVFIGGKGHETYQ
LVGGEVLPFDDRLVVAQYLARERE
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atggccagagcactgaataatctactccgtgacgtcgaaatcctgcagaccgcaggaccg
ttggacgtgcccgtcacgggtattgcctacgacagcaggcggattcaggcaggcaacgtt
tttgtggcgttgcccggagttcgggtggacggaaaccgtttcatcccggaagcggtccgt
agcggggcgagtgccgtgattaccgagaccgtcgggttttcggagtgtcctgccaccgtg
gtgcgggtatccgacagtcgtaaggcgatggcgcgcatggccgccaactactatggccat
ccgtgcgccgggttgaagatgatcggggttaccggaacaaacggcaagacgacgaccacg
ctgctgctcgagagtattttgaagaggggcggccattcggtcggggttttgggaacgctc
ttctaccgttggggggcgaagagcaaaacggccggtatgacgacgccggagtcgctggat
ttgcagggattgttttacgagatgcgcgaggacggggtcacccatgtcgtgatggaggtt
tcttcacatgccctggcccaggggagagtggccgaatgcgccttcgacgccgccgttttc
acgaatctgtcccaggatcacctcgattatcacgtcaccatggaggactacttcgcggcc
aagagcctgctcttttcggaatacctcaggaccggttcggttgccgtgatcaacggggac
gatccgtacggggcgcgcctcgtggaaaaagccggcccgggggcctggagttactcaacc
ggttccgaggcggcccgcgcccatgtgaagtccgcccgactcaccgcgtccggcatcgag
gcccggttgtgcgggcccgacggaagcatggacattcattcgcccctgatcgggcgtttg
aacctctacaatattctggctgccgtgaccgcttccctggccatgggcgtccccgaagcg
gcgataagggagggcgtggcggggcttacctccgtggatgggcgtttgcagcgcgttgcg
tcgcccggtacgggttttgaggtggtggtggattatgcgcacactccggatgcgatggag
aaaagcctggggtgtctgagggagatgaccgcggggcgcctgctggtggtgttcggctgc
ggcggagaccgggaccggggcaagcgccctctcatgggaaaggtggcgggggcgttgggg
gacctggtgatcgtgaccagcgacaatccgcgcagcgaggtcccggagagaatcatcgat
gaaatcgagcccggagtccgggcttccggcctggaacggatccttgccgctgagcctgga
aacggcgctcggggttacatcgtggaggtggaccgaaaatcggcgatcgagaaggccctg
gcgtgggcgcgtccgggcgatacggtgttcatcggcggcaaggggcatgagacgtaccag
cttgtcggaggcgaggttctgccgttcgacgatcgactggtggtcgcgcagtacctggcg
cgagagcgggaatga

DBGET integrated database retrieval system