KEGG   Syntrophobacter fumaroxidans: Sfum_3548Help
Entry
Sfum_3548         CDS       T00418                                 

Definition
2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
sfu  Syntrophobacter fumaroxidans
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sfu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sfum_3548
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Sfum_3548
  Amino acid metabolism
   00310 Lysine degradation
    Sfum_3548
Enzymes [BR:sfu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Sfum_3548
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4346415..4347749
Genome map
AA seq 444 aa AA seqDB search
MQIEVKVPEVGESVQEALLVQWYRRDGDMVRKGEILFIIETDKVTLEVSADADGLLKILV
PEGQTVRIGTVVATIDSEAREAKPLPARQPEAEKTGEVVEKAAEREAAAAPVPVSPVRAP
SPPGAGTAEASPRPIVSESVKELLAERGLDAAQITPSGPGGRLTRGDVLAFLDERGQETT
GKPDEKTVTEPAVMPEAPRRVPPRRQVVLAPEELTVRKPMTPIRRRIADHMLQARLNTAM
LTTFNEIDMSRLQEIRKQFRDLFQKKHSVSLGIMSFFLKAAAVALKELPELNAFIEGHEI
VYHNYIHIGVAVGAERGLVVPVIRDVDKLGFADLEKAILDHVRKIRENRLEMSDLEGGTF
TISNGGVYGSLMSTPILNSPQSGILGLHKIEDRPVVVDGRIVVRPMMYVALSYDHRIVDG
REAVTFLKRIKECIENPERIMVEI
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgcagatcgaggtgaaagtgcccgaggtcggcgaatccgtgcaggaagccctgctcgtc
cagtggtacaggcgtgatggcgacatggtgcgcaagggcgagatactctttattatcgaa
acggacaaagtcacgctggaagtctcggcagacgcggacgggctgctgaaaatcctggtc
ccggaaggacagacggtccgcatcgggacggtggtagcgacaatcgattcggaggctcgc
gaggcgaagcccctccccgcccggcagccggaagcggagaaaaccggagaggtcgtcgaa
aaggcggcggaacgggaggccgcggcggcaccggttcccgtctcgcccgtccgggcgccg
tcgccgcccggagccggcactgcggaagcctcgccccggccgatcgtgtccgaatcggtg
aaggagctcctcgccgagagggggctggacgccgcacagattaccccaagcggccccggg
ggcaggctgacccggggagacgtcctcgcgttcctcgatgaacgagggcaagaaacgacg
ggaaaaccggatgaaaagaccgtcacggaacccgcggtcatgcccgaggcgccccgccgg
gtgccgccgcggcggcaggtcgttttagccccggaggaattgacggtccgcaagcccatg
accccgattcgccgaagaatcgcggaccatatgctccaggcgcgcctgaacaccgccatg
ctcaccacattcaacgaaatcgacatgagcaggctccaggaaataaggaaacagttccgc
gatctttttcagaagaagcactcggtgtccctggggatcatgtcgttcttcctcaaggct
gccgcggtcgcgctcaaggaactgcccgagctgaacgcattcatcgaaggccacgaaatc
gtctatcacaactacatccacatcggcgtcgcggtcggcgctgaacgcgggctggtggtt
ccggtcatccgcgatgtggacaagctcggttttgcggacctggaaaaggccattctcgac
catgtgcgcaagatcagggagaaccggctggaaatgtcggacctggaagggggcaccttc
acgatcagcaacggcggcgtatacgggtcgctcatgagcactcccatactgaacagccct
cagagcggcattctcggcctgcacaagatcgaggaccgcccggtggtcgtggacggccgg
attgtcgttcgtcccatgatgtacgtggcgctgagctacgatcacaggatcgtggacgga
agggaagccgtcacgttcctgaagcggatcaaggaatgcatcgaaaatccggaacggatc
atggtggagatataa

  All links  
No link information was found.   
DBGET integrated database retrieval system