KEGG   Syntrophobacter fumaroxidans: Sfum_3548Help
Entry
Sfum_3548         CDS       T00418                                 

Definition
(RefSeq) 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
  KO
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
sfu  Syntrophobacter fumaroxidans
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sfu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sfum_3548
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Sfum_3548
  Amino acid metabolism
   00310 Lysine degradation
    Sfum_3548
Enzymes [BR:sfu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Sfum_3548
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4346415..4347749
Genome map
AA seq 444 aa AA seqDB search
MQIEVKVPEVGESVQEALLVQWYRRDGDMVRKGEILFIIETDKVTLEVSADADGLLKILV
PEGQTVRIGTVVATIDSEAREAKPLPARQPEAEKTGEVVEKAAEREAAAAPVPVSPVRAP
SPPGAGTAEASPRPIVSESVKELLAERGLDAAQITPSGPGGRLTRGDVLAFLDERGQETT
GKPDEKTVTEPAVMPEAPRRVPPRRQVVLAPEELTVRKPMTPIRRRIADHMLQARLNTAM
LTTFNEIDMSRLQEIRKQFRDLFQKKHSVSLGIMSFFLKAAAVALKELPELNAFIEGHEI
VYHNYIHIGVAVGAERGLVVPVIRDVDKLGFADLEKAILDHVRKIRENRLEMSDLEGGTF
TISNGGVYGSLMSTPILNSPQSGILGLHKIEDRPVVVDGRIVVRPMMYVALSYDHRIVDG
REAVTFLKRIKECIENPERIMVEI
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgcagatcgaggtgaaagtgcccgaggtcggcgaatccgtgcaggaagccctgctcgtc
cagtggtacaggcgtgatggcgacatggtgcgcaagggcgagatactctttattatcgaa
acggacaaagtcacgctggaagtctcggcagacgcggacgggctgctgaaaatcctggtc
ccggaaggacagacggtccgcatcgggacggtggtagcgacaatcgattcggaggctcgc
gaggcgaagcccctccccgcccggcagccggaagcggagaaaaccggagaggtcgtcgaa
aaggcggcggaacgggaggccgcggcggcaccggttcccgtctcgcccgtccgggcgccg
tcgccgcccggagccggcactgcggaagcctcgccccggccgatcgtgtccgaatcggtg
aaggagctcctcgccgagagggggctggacgccgcacagattaccccaagcggccccggg
ggcaggctgacccggggagacgtcctcgcgttcctcgatgaacgagggcaagaaacgacg
ggaaaaccggatgaaaagaccgtcacggaacccgcggtcatgcccgaggcgccccgccgg
gtgccgccgcggcggcaggtcgttttagccccggaggaattgacggtccgcaagcccatg
accccgattcgccgaagaatcgcggaccatatgctccaggcgcgcctgaacaccgccatg
ctcaccacattcaacgaaatcgacatgagcaggctccaggaaataaggaaacagttccgc
gatctttttcagaagaagcactcggtgtccctggggatcatgtcgttcttcctcaaggct
gccgcggtcgcgctcaaggaactgcccgagctgaacgcattcatcgaaggccacgaaatc
gtctatcacaactacatccacatcggcgtcgcggtcggcgctgaacgcgggctggtggtt
ccggtcatccgcgatgtggacaagctcggttttgcggacctggaaaaggccattctcgac
catgtgcgcaagatcagggagaaccggctggaaatgtcggacctggaagggggcaccttc
acgatcagcaacggcggcgtatacgggtcgctcatgagcactcccatactgaacagccct
cagagcggcattctcggcctgcacaagatcgaggaccgcccggtggtcgtggacggccgg
attgtcgttcgtcccatgatgtacgtggcgctgagctacgatcacaggatcgtggacgga
agggaagccgtcacgttcctgaagcggatcaaggaatgcatcgaaaatccggaacggatc
atggtggagatataa

DBGET integrated database retrieval system