KEGG   Syntrophobacter fumaroxidans: Sfum_3548Help
Entry
Sfum_3548         CDS       T00418                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase E2 component
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
sfu  Syntrophobacter fumaroxidans
Pathway
sfu00020  Citrate cycle (TCA cycle)
sfu00310  Lysine degradation
sfu01100  Metabolic pathways
sfu01110  Biosynthesis of secondary metabolites
sfu01120  Microbial metabolism in diverse environments
sfu01130  Biosynthesis of antibiotics
sfu01200  Carbon metabolism
Module
sfu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sfu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sfu00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Sfum_3548
  Amino acid metabolism
   00310 Lysine degradation
    Sfum_3548
Enzymes [BR:sfu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Sfum_3548
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 E3_binding QRPTase_N
Motif
Other DBs
NCBI-ProteinID: ABK19218
JGI: Sfum3548
UniProt: A0LP66
Position
4346415..4347749
Genome map
AA seq 444 aa AA seqDB search
MQIEVKVPEVGESVQEALLVQWYRRDGDMVRKGEILFIIETDKVTLEVSADADGLLKILV
PEGQTVRIGTVVATIDSEAREAKPLPARQPEAEKTGEVVEKAAEREAAAAPVPVSPVRAP
SPPGAGTAEASPRPIVSESVKELLAERGLDAAQITPSGPGGRLTRGDVLAFLDERGQETT
GKPDEKTVTEPAVMPEAPRRVPPRRQVVLAPEELTVRKPMTPIRRRIADHMLQARLNTAM
LTTFNEIDMSRLQEIRKQFRDLFQKKHSVSLGIMSFFLKAAAVALKELPELNAFIEGHEI
VYHNYIHIGVAVGAERGLVVPVIRDVDKLGFADLEKAILDHVRKIRENRLEMSDLEGGTF
TISNGGVYGSLMSTPILNSPQSGILGLHKIEDRPVVVDGRIVVRPMMYVALSYDHRIVDG
REAVTFLKRIKECIENPERIMVEI
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgcagatcgaggtgaaagtgcccgaggtcggcgaatccgtgcaggaagccctgctcgtc
cagtggtacaggcgtgatggcgacatggtgcgcaagggcgagatactctttattatcgaa
acggacaaagtcacgctggaagtctcggcagacgcggacgggctgctgaaaatcctggtc
ccggaaggacagacggtccgcatcgggacggtggtagcgacaatcgattcggaggctcgc
gaggcgaagcccctccccgcccggcagccggaagcggagaaaaccggagaggtcgtcgaa
aaggcggcggaacgggaggccgcggcggcaccggttcccgtctcgcccgtccgggcgccg
tcgccgcccggagccggcactgcggaagcctcgccccggccgatcgtgtccgaatcggtg
aaggagctcctcgccgagagggggctggacgccgcacagattaccccaagcggccccggg
ggcaggctgacccggggagacgtcctcgcgttcctcgatgaacgagggcaagaaacgacg
ggaaaaccggatgaaaagaccgtcacggaacccgcggtcatgcccgaggcgccccgccgg
gtgccgccgcggcggcaggtcgttttagccccggaggaattgacggtccgcaagcccatg
accccgattcgccgaagaatcgcggaccatatgctccaggcgcgcctgaacaccgccatg
ctcaccacattcaacgaaatcgacatgagcaggctccaggaaataaggaaacagttccgc
gatctttttcagaagaagcactcggtgtccctggggatcatgtcgttcttcctcaaggct
gccgcggtcgcgctcaaggaactgcccgagctgaacgcattcatcgaaggccacgaaatc
gtctatcacaactacatccacatcggcgtcgcggtcggcgctgaacgcgggctggtggtt
ccggtcatccgcgatgtggacaagctcggttttgcggacctggaaaaggccattctcgac
catgtgcgcaagatcagggagaaccggctggaaatgtcggacctggaagggggcaccttc
acgatcagcaacggcggcgtatacgggtcgctcatgagcactcccatactgaacagccct
cagagcggcattctcggcctgcacaagatcgaggaccgcccggtggtcgtggacggccgg
attgtcgttcgtcccatgatgtacgtggcgctgagctacgatcacaggatcgtggacgga
agggaagccgtcacgttcctgaagcggatcaaggaatgcatcgaaaatccggaacggatc
atggtggagatataa

DBGET integrated database retrieval system