KEGG   Syntrophobacter fumaroxidans: Sfum_3643Help
Entry
Sfum_3643         CDS       T00418                                 

Definition
glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
sfu  Syntrophobacter fumaroxidans
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:sfu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Sfum_3643
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Sfum_3643
Enzymes [BR:sfu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Sfum_3643
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4449926..4451104
Genome map
AA seq 392 aa AA seqDB search
MQDLQDRKKFFSRCRRVVIKVGSAVLTGPRGLNRVMIHRLSDQIAEFLERERGREVVIVT
SGAVASGIRKIGLSERPRTIPHKQATAAVGQGALMEAWEGAFDKYDLLVAQLLLTSEDLA
HRHRYLNARNTLETLLSWGILPIINENDTVVVEEIKFGDNDQLSAMIAGLIGADLVVNLT
DTQGLYDCDPRLNSSAGLIPVVHRVDAKILACATPQPGSVGTGGMLSKVNAARKCLASGI
PMIIAPGRERDILLRLFDGEMLGTVFLPRKRVYQGRKVWLANLPKPAGDLVLDAGAVLAL
RKKGKSLLPIGIREVRGTFGVGSPVRCLDEAGNVVGVGLSNYRSAEIESIKGHRSEEIET
LIGYKHSDEVIHRNNFVLAGEMMEETDGGPDA
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgcaggatttgcaggatcgcaaaaagtttttcagccgctgccgccgggtggtgatcaag
gtcggcagtgccgtgttgaccgggccccgggggttgaaccgggtgatgatccatcggctg
agcgaccagattgccgagttcctggagcgggaacgcggccgggaggtggtgatcgtcact
tccggggcggttgcgtccggcattcgcaagatcgggctcagcgaacggccccggaccatt
ccgcacaagcaggcgacggcggccgtgggccagggcgcgttgatggaggcctgggaaggc
gctttcgacaagtacgacctgctcgtcgcccaactgcttctcaccagtgaggatctcgcg
catcggcaccggtacctgaatgcgcgcaataccctggagaccttgctgtcctggggaata
ttgccgatcatcaacgagaatgatacggtagtggtggaagagatcaagttcggggacaac
gatcagctctcggcgatgatcgccggtctgatcggggccgatctggtggtcaacctgacg
gacactcaggggctgtatgactgcgatccgcgcctgaacagctcggccggcctgatcccc
gtggtgcaccgcgtggatgcgaaaatcctggcctgcgccacgccgcagccgggatcggtg
ggaacggggggcatgctgagcaaggtcaatgcggcgaggaagtgccttgcttcgggaatc
cccatgatcattgccccgggcagggaacgtgatatactgctgaggctctttgacggcgaa
atgctcggcaccgttttccttccccgaaagcgggtgtatcagggcagaaaggtgtggctc
gccaatttgccgaagccggcgggcgacctggttctcgatgcgggagccgtcctggccctg
aggaagaaggggaagtcgctgctgcccatcggcatccgcgaggtgagggggactttcgga
gtgggctcgcccgtgcggtgcctggatgaggccgggaacgtcgtcggcgtcggactgagc
aactacaggtcggccgagatcgagagtatcaagggtcatcgcagcgaggagatcgaaacc
ctcatcggctacaagcattccgacgaggtgattcaccggaacaacttcgtgttggccggg
gaaatgatggaagaaacggacggagggccggatgcgtga

DBGET integrated database retrieval system