KEGG   Syntrophobacter fumaroxidans: Sfum_3651Help
Entry
Sfum_3651         CDS       T00418                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
sfu  Syntrophobacter fumaroxidans
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:sfu00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4458756..4459649
Genome map
AA seq 297 aa AA seqDB search
MRGIRKGHALALRVGTPAKINLWLEIVRKREDGYHDLSSLMLPVAVYDHVEVAWSHEGGV
RLSCDSAEVPDDRGNLAWRAADAYLEAAGVTRGVSIRLEKNIPVGAGMGGGSSDAAAVLL
ALNRLSENPLSEAVLHRLAVGLGADVPFFLHCVPALATGIGERLLPVHGIPDYPLLLVKP
PISVSTGWVYGSLKLTRGESRIKLRSFLDRPWHLSEVLRNDLETVTLNEYPQLGQIKCWL
MENGAVGSLMSGSGPTVFGVFAEQRLADGAGELARRVWKDCRVDVTRVLGTPVSARS
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgcgaggaatccggaagggacatgcattggcacttagggtcggcactcccgcgaaaatc
aatctatggctcgagatcgtccggaaacgggaggatggctaccacgacctgtccagcctc
atgcttccggtggcggtttacgatcacgtcgaagtggcctggagtcacgaagggggcgtt
cgcctgagctgcgacagcgccgaggtgcccgatgatcgcgggaaccttgcctggcgggcc
gcggacgcctatctcgaagctgcgggggtcactcgtggagtttcgattcggctggagaaa
aacataccggtgggcgcgggaatgggtggagggagttcagacgccgcggcggtgcttctc
gcgctgaaccggttgagcgagaatccgctgtccgaagcggttttgcatcggctcgccgtg
ggccttggcgcggatgtcccttttttcctccattgtgttccggccctggcgaccggcatc
ggggagcgactgttgccggtgcacgggattcccgattaccccctgctgctcgtcaagccg
cccatatccgtttccacgggctgggtttacggaagtttgaagttgacaaggggagaaagc
cgcattaaactccgttcgtttctggacaggccttggcacttgtccgaggttctccggaac
gacctggaaaccgttaccctgaacgaataccctcagcttgggcaaatcaagtgctggctc
atggaaaacggggctgtggggtctttgatgagcggtagcggtccaactgtttttggggtc
tttgcggagcagcgtttggcggacggtgcgggggaactggctcgccgggtttggaaagat
tgccgggttgacgtgacacgcgttctggggactccggtttccgcgcgatcatag

DBGET integrated database retrieval system