KEGG   Syntrophobacter fumaroxidans: Sfum_3651Help
Entry
Sfum_3651         CDS       T00418                                 

Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
sfu  Syntrophobacter fumaroxidans
Pathway
sfu00900  Terpenoid backbone biosynthesis
sfu01100  Metabolic pathways
sfu01110  Biosynthesis of secondary metabolites
sfu01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sfu00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Sfum_3651
Enzymes [BR:sfu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Sfum_3651
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: ABK19321
JGI: Sfum3651
UniProt: A0LPG9
Position
4458756..4459649
Genome map
AA seq 297 aa AA seqDB search
MRGIRKGHALALRVGTPAKINLWLEIVRKREDGYHDLSSLMLPVAVYDHVEVAWSHEGGV
RLSCDSAEVPDDRGNLAWRAADAYLEAAGVTRGVSIRLEKNIPVGAGMGGGSSDAAAVLL
ALNRLSENPLSEAVLHRLAVGLGADVPFFLHCVPALATGIGERLLPVHGIPDYPLLLVKP
PISVSTGWVYGSLKLTRGESRIKLRSFLDRPWHLSEVLRNDLETVTLNEYPQLGQIKCWL
MENGAVGSLMSGSGPTVFGVFAEQRLADGAGELARRVWKDCRVDVTRVLGTPVSARS
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgcgaggaatccggaagggacatgcattggcacttagggtcggcactcccgcgaaaatc
aatctatggctcgagatcgtccggaaacgggaggatggctaccacgacctgtccagcctc
atgcttccggtggcggtttacgatcacgtcgaagtggcctggagtcacgaagggggcgtt
cgcctgagctgcgacagcgccgaggtgcccgatgatcgcgggaaccttgcctggcgggcc
gcggacgcctatctcgaagctgcgggggtcactcgtggagtttcgattcggctggagaaa
aacataccggtgggcgcgggaatgggtggagggagttcagacgccgcggcggtgcttctc
gcgctgaaccggttgagcgagaatccgctgtccgaagcggttttgcatcggctcgccgtg
ggccttggcgcggatgtcccttttttcctccattgtgttccggccctggcgaccggcatc
ggggagcgactgttgccggtgcacgggattcccgattaccccctgctgctcgtcaagccg
cccatatccgtttccacgggctgggtttacggaagtttgaagttgacaaggggagaaagc
cgcattaaactccgttcgtttctggacaggccttggcacttgtccgaggttctccggaac
gacctggaaaccgttaccctgaacgaataccctcagcttgggcaaatcaagtgctggctc
atggaaaacggggctgtggggtctttgatgagcggtagcggtccaactgtttttggggtc
tttgcggagcagcgtttggcggacggtgcgggggaactggctcgccgggtttggaaagat
tgccgggttgacgtgacacgcgttctggggactccggtttccgcgcgatcatag

DBGET integrated database retrieval system