KEGG   Shigella flexneri 8401 (serotype 5b): SFV_0106Help
Entry
SFV_0106          CDS       T00377                                 

Gene name
aceF
Definition
(GenBank) pyruvate dehydrogenase (dihydrolipoyltransacetylase component)
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sfv  Shigella flexneri 8401 (serotype 5b)
Pathway
sfv00010  Glycolysis / Gluconeogenesis
sfv00020  Citrate cycle (TCA cycle)
sfv00620  Pyruvate metabolism
sfv01100  Metabolic pathways
sfv01110  Biosynthesis of secondary metabolites
sfv01120  Microbial metabolism in diverse environments
sfv01130  Biosynthesis of antibiotics
sfv01200  Carbon metabolism
Module
sfv_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sfv00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SFV_0106 (aceF)
   00020 Citrate cycle (TCA cycle)
    SFV_0106 (aceF)
   00620 Pyruvate metabolism
    SFV_0106 (aceF)
Enzymes [BR:sfv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SFV_0106 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N GCV_H HlyD_D23 NQRA HlyD_3
Motif
Other DBs
NCBI-ProteinID: ABF02391
UniProt: Q0T885
Position
123629..125509
Genome map
AA seq 626 aa AA seqDB search
MAIEIKVPDIGADEVEITEILVKVGDKVEAEQSLITVEGDKASMEVPSPQAGIVKEIKVS
VGDKTQTGALIMIFDSADGAADAAPAQAEEKKEAAPAAAPAAAAAKDVNVPDIGSDEVEV
TEILVKVGDKVEAEQSLITVEGDKASMEVPAPFAGTVKEIKVNVGDKVSTGSLIMVFEVA
GEAGAAAPAAKQEATPAATPAPAAGVKEVNVPDIGGDEVEVTEVMVKVGDKVAAEQSLIT
VEGDKASMEVPAPFAGVVKELKVNVGDKVKTGSLIMIFEVEGAAPAAAPAKQEAAAPAPA
AKAEAPAAKAEGKSEFAENDAYVHATPLIRRLAREFGVNLAKVKGTGRKGRILREDVQAY
VKEAIKRAEAAPAATGGGIPGMLPWPKVDFSKFGEIEEVELGRIQKISGANLSRNWVMIP
HVTHFDKTDITELEAFRKQQNEEAAKRKLDVKITPVVFIMKAVAAALEQMPRFNSSLSED
GQRLTLKKYINIGVAVDTPNGLVVPVFKDVNKKGIIELSRELMTISKKARDGKLTAGEMQ
GGCFTISSIGGLGTTHFAPIVNAPEVAILGVSKSAMEPVWNGKEFVPRLMLPISLSFDHR
VIDGADGARFITIINNTLSDIRRLVM
NT seq 1881 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgaaatcaaagtaccggacatcggggctgatgaagttgaaatcaccgagatc
ctggtcaaagtgggcgacaaagttgaagccgaacagtcgctgatcaccgtagaaggcgac
aaagcctctatggaagttccatctccgcaggcgggtatcgttaaagagatcaaagtctct
gttggcgataaaacccagaccggcgcactgattatgattttcgattccgccgacggtgca
gcagacgctgcacctgctcaggcagaagagaagaaagaagcagctccggcagcagcaccc
gcggctgcggcggcaaaagacgttaacgttccggatatcggcagcgacgaagttgaagtg
accgaaatcctggtgaaagttggcgataaagttgaagctgaacagtcgctgatcaccgta
gaaggcgacaaggcttctatggaagttccggctccgtttgcaggtaccgtgaaagagatc
aaagtgaacgtgggtgacaaagtgtctaccggctcgctgattatggtcttcgaagtcgcg
ggtgaagcaggcgcggcagctccggcggctaaacaggaagcgactccggcagcgacccct
gcaccagcagctggcgtgaaagaagttaacgttccggatatcggcggtgacgaagttgaa
gtgaccgaagtgatggtgaaagtgggcgacaaagttgccgctgaacagtcactgattacc
gtagaaggcgataaagcttctatggaagttccggctccgtttgcaggcgtcgtgaaggaa
ctgaaagtcaacgttggcgataaagtgaaaactggttcgctgattatgatcttcgaagtt
gaaggcgcagcgcctgcggcagctcctgcgaaacaggaagcggcagcgccggctccggca
gcaaaagctgaagctccggctgcgaaagcggaaggcaaatctgaatttgctgaaaacgac
gcttacgttcacgcgaccccgctgatccgccgtctggcacgcgagtttggcgttaacctg
gcgaaagtgaagggcactggccgtaaaggtcgtatcctgcgcgaagacgttcaggcttac
gtgaaagaagctatcaaacgtgcagaagcagctccggcggcgactggcggtggtatccct
ggcatgctgccgtggccgaaggtggacttcagcaagtttggcgaaatcgaagaagtggaa
ctgggccgtatccagaaaatttctggtgctaacctgagccgtaactgggtgatgatcccg
catgttacccacttcgacaaaaccgatatcaccgagctggaagcgttccgtaaacagcag
aacgaagaagcggcgaaacgtaagctggatgtgaagatcaccccggttgtcttcatcatg
aaagccgttgctgcagctcttgagcagatgcctcgcttcaatagttcgctgtcggaagac
ggtcagcgtctgaccctgaagaaatacatcaacatcggtgtggcggtggataccccgaac
ggtctggttgttccggtattcaaagacgtcaacaagaaaggcatcatcgagctgtctcgc
gagctgatgactatttctaagaaagcgcgtgacggtaagctgactgcgggcgaaatgcag
ggcggttgcttcaccatctccagcatcggcggcctgggtactacccacttcgcgccgatt
gtgaacgcgccggaagtggctatcctcggcgtttccaagtccgcgatggagccggtgtgg
aatggtaaagagttcgtgccgcgtctgatgctgccgatttctctctccttcgaccaccgc
gtgatcgacggtgctgatggtgcccgtttcattaccatcattaacaacacgctgtctgac
attcgccgtctggtgatgtaa

DBGET integrated database retrieval system