KEGG   Shigella flexneri 8401 (serotype 5b): SFV_0212Help
Entry
SFV_0212          CDS       T00377                                 

Definition
lysozyme
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
sfv  Shigella flexneri 8401 (serotype 5b)
Brite
Enzymes [BR:sfv01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     SFV_0212
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(237775..238308)
Genome map
AA seq 177 aa AA seqDB search
MSAKIKYGLSAAVLALIAAGASAPQILDQFLNEKEGNHTTAYRDGSGIWTICRGATMVDG
KPVIPGMKLSKEKCDQVNAIERDKALAWVERNIKVPLTEPQKAGIASFCPYNIGPGKCFP
STFYKRLNAGDRKGACEAIRWWIKDVGRDCRIRSNNCYGQVIRRDQESALACWEIDQ
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcaaaaatcaaatacggcctgtcggctgctgttctggcgctgattgccgcaggc
gcgtctgctccccagatacttgaccagtttctgaacgaaaaagagggtaatcacacaacg
gcataccgtgatggttctggcatatggaccatctgtcgtggtgccacaatggtggatggt
aagcctgtcataccgggaatgaagctgtcgaaggaaaaatgtgaccaggttaacgctatt
gaacgtgataaggcgctggcatgggtggagcgcaatattaaagtacctctgaccgaaccc
cagaaagcgggtatagcgtcattttgcccctataacattggccccggtaagtgtttcccg
tcgacgttttataagcggctgaatgccggtgatcgtaagggcgcatgcgaggcgattcgc
tggtggataaaagatgttgggcgcgattgccgcatacgttcaaataactgctatggacag
gttattcgtcgtgaccaggaaagcgcattagcctgttgggagatagatcaatga

DBGET integrated database retrieval system