KEGG   Shigella flexneri 8401 (serotype 5b): SFV_0333Help
Entry
SFV_0333          CDS       T00377                                 

Gene name
hemB
Definition
(GenBank) delta-aminolevulinic acid dehydratase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
sfv  Shigella flexneri 8401 (serotype 5b)
Pathway
sfv00860  Porphyrin and chlorophyll metabolism
sfv01100  Metabolic pathways
sfv01110  Biosynthesis of secondary metabolites
sfv01120  Microbial metabolism in diverse environments
Module
sfv_M00121  Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:sfv00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SFV_0333 (hemB)
Enzymes [BR:sfv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     SFV_0333 (hemB)
Exosome [BR:sfv04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SFV_0333 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD ComA
Motif
Other DBs
NCBI-ProteinID: ABF02607
UniProt: Q0T7L9
Position
complement(351938..352945)
Genome map
AA seq 335 aa AA seqDB search
MHLNSTNIRQTMTDLIQRPRRLRKSPALRAMFEETTLSLNDLVLPIFVEEEIDDYKAVEA
MPGVMRIPEKHLAREIERIANAGIRSVMTFGISHHTDETGSDAWREDGLVARMSRICKQT
VPEMIVMSDTCFCEYTSHGHCGVLCEHGVDNDATLENLGKQAVVAAAAGADFIAPSAAMD
GQVQAIRQALDAAGFKDTAIMSYSTKFASSFYGPFREAAGSALKGDRKSYQMTPMNRREA
IRESLLDEAQGADCLMVKPAGAYLDIVRELRERTELPIGAYQVSGEYAMIKFAALAGAID
EEKVVLESLGSIKRAGADLIFSYFALDLAEKKILR
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
gtgcaccttaattccacaaacatcaggcagaccatgacagacttaatccaacgccctcgt
cgcctgcgcaaatctcctgcgctgcgcgctatgtttgaagagacaacacttagccttaac
gacctggtgttgccgatctttgttgaagaagaaattgacgactacaaagccgttgaagcc
atgccaggcgtgatgcgcattccagagaaacatctggcacgcgaaattgaacgcatcgcc
aacgccggtatccgttccgtaatgacttttggcatctctcaccataccgatgaaaccggc
agcgacgcctggcgggaagatggactggtggcgcgtatgtcgcgcatctgcaagcagact
gtgccagaaatgatcgtcatgtcagacacttgtttctgtgaatacacttctcacggtcac
tgcggtgtgctgtgcgagcatggcgtcgacaacgacgcgactctggaaaatttaggcaag
caagccgtggttgcagctgctgcaggcgcagacttcatcgccccttccgccgcgatggac
ggccaggtacaggcgattcgtcaggcgctggacgctgcaggctttaaagatacggcgatt
atgtcgtattcgaccaagttcgcctcttccttttatggcccgttccgtgaagctgcagga
agcgcattaaaaggcgaccgcaaaagctatcagatgaccccaatgaaccgtcgcgaggcg
attcgtgagtcactgctggatgaagcccagggcgcagactgcctgatggttaaacctgct
ggagcgtacctcgacatcgtgcgtgagctgcgtgaacgtactgaattgccgattggcgcg
tatcaggtgagcggtgagtacgcgatgattaagttcgccgcgctggcgggtgctatagat
gaagagaaagtcgtgctcgaaagcttaggttcaattaagcgtgcgggtgcggatctgatt
ttcagctactttgcgctggatttggctgagaagaagattctgcgttaa

DBGET integrated database retrieval system