KEGG   Shigella flexneri 8401 (serotype 5b): SFV_0726Help
Entry
SFV_0726          CDS       T00377                                 

Gene name
ybcS
Definition
bacteriophage lambda lysozyme
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
sfv  Shigella flexneri 8401 (serotype 5b)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(758930..759445)
Genome map
AA seq 171 aa AA seqDB search
MSPSLRKAVAVAIGGGAVAIASVLITGPGGNDGLEGVSYIPYKDIIGVWTVCHGHTGKDI
MPGKTYTEAECKALLNKDLVTVARQINPYIKVDIPETTRGALYSFVYNVGAGNFRTSTLL
RKINQGDIKGAYDQLRRWTYAGGKQWKGLMTRREIEREVCLWGKRPISDVL
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atgtcgccatcattacgcaaggctgttgcagttgctattggtggcggggctgttgctata
gcatctgtgttaatcactggcccaggtggtaacgatggtctggaaggtgtcagctacata
ccatacaaagatatcattggtgtatggactgtatgtcacggacacaccggaaaagacatc
atgcctggtaaaacgtataccgaagcagaatgcaaagctctcctgaataaagaccttgtc
actgtcgccagacaaattaacccgtacatcaaagtcgatataccggaaacaacgcgcggc
gctctttactcgttcgtttacaacgtgggcgctggcaatttcagaacatcgacgcttctt
cgcaaaataaaccagggcgatatcaaaggcgcatatgaccagctacgtcgctggacatat
gctggcggtaagcaatggaaagggctgatgacccgtcgtgagattgagcgtgaagtctgt
ttgtggggtaagcgccccatcagcgacgtcttgtga

DBGET integrated database retrieval system