KEGG   Shigella flexneri 8401 (serotype 5b): SFV_1127Help
Entry
SFV_1127          CDS       T00377                                 

Gene name
ycfO
Definition
beta-hexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
sfv  Shigella flexneri 8401 (serotype 5b)
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sfv00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SFV_1127 (ycfO)
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    SFV_1127 (ycfO)
Enzymes [BR:sfv01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     SFV_1127 (ycfO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1169904..1170917
Genome map
AA seq 337 aa AA seqDB search
MLDVEGYELDAEEREILAHPLVGGLILFTRNYHDPAQLRELVRQIRAASRNHLVVAVDQE
GGRVQRFREGFTRLPAAQSFAALLGMEEGGKLAQEAGWLMASEMIAMDIDISFAPVLDVG
HISAAIGERSYHADPQKALAIASRFIDGMHEAGMKTTGKHFPGHGAVTADSHKETPCDPR
PQAEIRAKDMSVFSSLIRENKLDAIMPAHVIYSDVDPRPASGSPYWLKTVLRQELGFDGV
IFSDDLSMEGAAIMGSYAERGQASLDAGCDMILVCNNRKGAVSVLDNLSPIKAERVTRLY
HKGSFSRQELMDSARWKAISTRLNQLHERWQEEKAGH
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgttggatgtcgaaggttacgaactggacgcggaagagcgtgaaatactggcgcatccg
ctggtgggggggctgattctctttacgcgtaactatcatgatcctgcccagttacgtgaa
ctggtgcgccagatccgcgcagcatcgcgcaatcatctggtggtggcggtagatcaggaa
ggtggacgcgtgcagcgttttcgcgaaggttttacccgcttaccggcagcacaatccttt
gctgcgctgttgggaatggaagagggcggcaaactggcgcaagaggcgggttggctgatg
gccagcgaaatgatcgctatggatattgatatcagctttgcgccagtgctggatgtcggg
catatcagcgcggcgattggcgagcgttcttatcatgccgatccacaaaaagccctggca
attgccagccggtttattgatggtatgcatgaagccggaatgaaaacgaccgggaaacac
ttcccaggacacggtgcagtaacggcagactcacacaaagaaacaccgtgcgatccacgt
ccacaagcggagattcgcgctaaagatatgtcggtcttcagttccttaatccgcgaaaat
aaactcgacgccattatgcctgcgcatgtgatctacagtgatgttgatccgcgtccggcg
agcggttctccctactggctgaaaaccgttttgcgtcaggaactgggttttgacggcgtg
attttctctgacgatttatcgatggaaggtgccgcgattatgggcagttatgccgaacgc
gggcaggcatcactggatgcgggttgcgatatgatcctggtctgcaataatcgtaaaggg
gccgtcagcgtgttagataatctgtcaccgatcaaggcagaacgtgttacacgtttgtat
cataaaggttcattttcgcgacaggaactgatggactcggctcgctggaaagcgatcagc
acccgtctgaatcagttacatgaacgctggcaggaagagaaagcaggtcactaa

DBGET integrated database retrieval system