KEGG   Shigella flexneri 8401 (serotype 5b): SFV_1583Help
Entry
SFV_1583          CDS       T00377                                 

Gene name
yneH
Definition
glutaminase
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
sfv  Shigella flexneri 8401 (serotype 5b)
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sfv00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SFV_1583 (yneH)
   00330 Arginine and proline metabolism
    SFV_1583 (yneH)
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    SFV_1583 (yneH)
Enzymes [BR:sfv01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     SFV_1583 (yneH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1618886..1619680)
Genome map
AA seq 264 aa AA seqDB search
MDNAILENILRQVRPLIGQGKVADYIPALATVDGSRLGIAICTVDGQLFQAGDAQERFSI
QSISKVLSLVVAMRHYSEEEIWQRVGKDPSGSPFNSLVQLEMEQGIPRNPFINAGALVVC
DMLQGRLSAPRQRMLEVVRGLSGVSDISYDTVVARSEFEHSARNAAIAWLMKSFGNFHHD
VTTVLQNYFHYCALKMSCVELARTFVFLANQGKAIHIDEPVVTPMQARQINALMATSGMY
QNAGEFAWRVGLPAKLRVSPSLNN
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atggataatgcaattttagaaaacatcttgcggcaagtgcggccgctcattggtcagggt
aaagtcgcggattatattccggcgctggctacagtagacggttcccgattggggattgct
atctgtaccgttgacggacagctttttcaggccggagacgcgcaagaacgtttttccatt
cagtctatttccaaagtgctgagtctcgttgtcgccatgcgtcattactccgaagaggaa
atctggcaacgcgtcggcaaagatccgtctggatcaccgttcaattctttagtgcaactg
gaaatggaacagggtattccgcgtaatccgttcattaatgccggtgcgctggtggtctgc
gatatgttgcaagggcgactaagcgcaccacggcaacgtatgctggaagtcgtgcgcggc
ttaagcggtgtgtctgatatttcatacgatacggtggtagcgcgttccgaatttgaacat
tccgcgcgaaatgcggctatcgcctggctgatgaagtcgtttggcaatttccatcatgac
gtgacaaccgttctgcaaaactactttcattactgcgctctgaaaatgagctgtgtagag
ctggcccggacgtttgtctttctggctaatcaggggaaagctattcatattgatgaacct
gtggtgacgccaatgcaggcgcggcaaattaacgcgctgatggcgaccagtggtatgtac
cagaacgcgggggagtttgcctggcgggtgggactaccggcgaaattgcgggtatcgccg
tccttgaacaattga

DBGET integrated database retrieval system