KEGG   Shigella flexneri 8401 (serotype 5b): SFV_2409Help
Entry
SFV_2409          CDS       T00377                                 

Gene name
fadJ
Definition
multifunctional fatty acid oxidation complex subunit alpha (EC:1.1.1.35 4.2.1.17 5.1.2.3)
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
sfv  Shigella flexneri 8401 (serotype 5b)
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:sfv00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SFV_2409 (fadJ)
   01212 Fatty acid metabolism
    SFV_2409 (fadJ)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SFV_2409 (fadJ)
   00650 Butanoate metabolism
    SFV_2409 (fadJ)
  Lipid metabolism
   00071 Fatty acid degradation
    SFV_2409 (fadJ)
   01040 Biosynthesis of unsaturated fatty acids
    SFV_2409 (fadJ)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SFV_2409 (fadJ)
   00310 Lysine degradation
    SFV_2409 (fadJ)
   00380 Tryptophan metabolism
    SFV_2409 (fadJ)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SFV_2409 (fadJ)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SFV_2409 (fadJ)
   00281 Geraniol degradation
    SFV_2409 (fadJ)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    SFV_2409 (fadJ)
Enzymes [BR:sfv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     SFV_2409 (fadJ)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     SFV_2409 (fadJ)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     SFV_2409 (fadJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2459099..2461243)
Genome map
AA seq 714 aa AA seqDB search
MEMASAFTLNVRLDNIAIITIDVPDEKMNTLKAEFASQVRAIIKQLRENKELRGVVFISA
KPDNFIAGADINMIGNCKTAQEAEALARQGQQLMAEINALPIPVIAAIHGACLGGGLELA
LACHGRVCTDDPKTVLGLPEVQLGLLPGSGGTQRLPRLIGVSTALEMILTGKQLRAKQAL
KLGLVDDVVPHSILLEAAVELAKKDRPSSRPLPVRERILAGPLGRALLFKMVGKKTEHKT
QGNYPATERILEVVETGLAQGTSSGYDAEARAFGELAMTPQSQALRSIFFASTDVKKDPG
SDAPPAPLNSVGILGGGLMGGGIAYVTACKAGLPVRIKDINPQGINHALKYSWDQLEGKV
RRRHLKASERDKQLALISGTTDYRGFAHRDLIIEAVFENLELKQQMVAEVEQNCAAHTIF
ASNTSSLPIGDIAAHAARPEQVIGLHFFSPVEKMPLVEIIPHAGTSAQTIATTVKLAKKQ
GKTPIVVRDKAGFYVNRILAPYINEAIRMLTEGERVEHIDAALVKFGFPVGPIQLLDEVG
IDTGTKIIPVLEAAYGERFSAPANVVSSILNDDRKGRKNGRGFYLYGQKGRKSKKQVDPA
IYPLIGAQGQGRLSAPQVAERCVMLMLNEAVRCVDEQVIRSVRDGDIGAVFGIGFPPFLG
GPFRYIDSLGAGEVVAIMQRLATQYGSRFTPCERLVEMGARGESFWKTTATDLQ
NT seq 2145 nt NT seq  +upstreamnt  +downstreamnt
atggaaatggcatcagcgtttactcttaatgttcgtctggacaacattgctatcatcacc
atcgacgtaccggatgagaaaatgaataccctgaaggcggaatttgcctcgcaggtgcgc
gccattattaagcaactccgtgaaaacaaagagttgcgcggcgtggtgtttatctccgcg
aaaccggacaattttatcgccggagcagacatcaacatgattggcaactgcaaaacggcg
caagaagcggaagcactggcgcggcagggccaacagttgatggcggagattaatgctttg
cccattccggttatcgcggctattcatggcgcttgcctgggcggtgggctggagctggcg
ctggcgtgccacggtcgcgtttgtactgacgatcctaaaacggtgctcggtttgcctgaa
gtacaacttggattgttacccggttcaggcggcacccagcgtttaccgcgtctgataggc
gtcagtacagcattagagatgattctcaccggaaaacaacttcgggcgaaacaggcatta
aagctggggctggtggatgacgttgttccgcactccattttgctggaagccgctgttgag
ctggcgaagaaggatcgcccatcttcccgccctctacctgtacgcgagcgtattctggcg
gggccgttaggtcgtgcgctgctgttcaaaatggtcggcaagaaaacagaacacaaaact
caaggcaattatccggcgacagaacgcatcctggaggttgttgaaacgggattagcgcag
ggcaccagcagcggctatgacgctgaagctcgcgcctttggcgaactggcgatgacgccg
caatcgcaagctttgcgtagtatcttttttgccagtacggacgtgaagaaagatcccggt
agtgatgcaccgcctgcgccattaaacagcgtgggaattttaggtggtggcttgatgggc
ggcggtattgcttatgtcactgcttgtaaagcggggcttccggtcagaattaaagatatc
aacccgcagggcataaatcatgcgctgaagtacagttgggatcagctggagggcaaagtt
cgccgtcgtcatctcaaagccagcgaacgtgacaaacagctggcattaatctccggaacg
acggactatcgcggctttgcccatcgcgatctgattattgaagcggtgtttgaaaatctc
gaattaaaacaacagatggtggcggaagtggagcaaaattgcgccgctcataccattttt
gcttcgaacacgtcatctttaccgattggtgatatcgccgctcacgccgcgcgacctgag
caagttattggcctgcatttcttcagtccggtggaaaaaatgccgctggtagagattatt
cctcatgcgggtacatcggcgcaaaccatcgccactacggtaaaactggcgaaaaaacag
ggcaaaacgcccattgtcgtgcgtgacaaagccgggttttacgtcaatcgcatcttagcg
ccttacattaatgaagctatccgcatgctgaccgaaggtgaacgggtagagcacattgat
gccgcgctagtgaaatttggttttccggtaggcccaatccaacttttggatgaggtagga
atcgacaccgggactaaaattattcctgtactggaagccgcttatggagaacgttttagc
gcgcctgcaaatgttgtttcttcaattttgaacgacgatcgcaaaggcagaaaaaatggt
cggggtttctatctttatggtcagaaagggcgtaaaagcaaaaaacaggtcgatcctgcc
atttacccgctcattggcgcacaagggcaggggcgactctccgcaccgcaggttgctgaa
cggtgtgtgatgttgatgctgaatgaagcagtacgttgtgttgatgagcaggttatccgt
agcgtgcgtgacggggatattggtgcggtatttggcattggttttccgccatttctcggt
ggaccgttccgctatatcgattctctcggcgcgggcgaagtggttgcaataatgcaacga
ctggccacgcagtatggttcccgttttaccccttgcgagcgtttggtcgagatgggcgcg
cgtggggaaagtttttggaaaacaactgcaactgacctgcaataa

DBGET integrated database retrieval system