KEGG   Shigella flexneri 8401 (serotype 5b): SFV_2949Help
Entry
SFV_2949          CDS       T00377                                 

Gene name
bglA
Definition
6-phospho-beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
sfv  Shigella flexneri 8401 (serotype 5b)
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:sfv00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SFV_2949 (bglA)
Enzymes [BR:sfv01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     SFV_2949 (bglA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3016180..3017520
Genome map
AA seq 446 aa AA seqDB search
MIVKKLTLPKDFLWGGAVAAHQVEGGWNKGGKGPSICDVLTGGAHGVPREITKEVLPGKY
YPNHEAVDFYGHYKEDIKLFAEMGFKCFRTSIAWTRIFPKGDEAQPNEEGLKFYDSLFDE
LLKYNIEPVITLSHFEMPLHLVQQYGSWTNRKFVDFFVRFAEVVFERYKHKVKYWMTFNE
INNQRNWRAPLFGYCCSGVVYTEHDNPEETMYQVLHHQFVASALAVKAARRINPEMKVGC
MLAMVPLYPYSCNPDDVMFAQVSMRERYVFTDVQLCGYYPSYVLNEWERRGFNIKMEDGD
LDVLREGTCDYLGFSYYMTNAVKAEGGTGDAISGFEGSVPNPYVKASDWGWQIDPVGLRY
ALCELYERYQRPLFIVENGFGAYDKVEEDGSINDDYRIDYLRAHIKEMKKAVTYDGVDLM
GYTPWAASTACHSLPGSTANATALSM
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgatagtgaaaaaactcaccttaccgaaagatttcttatggggtggcgccgttgccgct
catcaggtcgaaggcggctggaacaaaggcggcaaaggaccgagcatttgtgacgttctg
accggtggcgcacacggcgtgccgcgcgaaatcaccaaagaagtcttgccaggaaaatac
tatccaaaccatgaagccgttgatttttatggtcactacaaggaagacatcaagctattt
gccgaaatgggcttcaaatgttttcggacttccatcgcctggacgcgtatttttccaaaa
ggtgatgaagctcagccaaacgaagaagggctgaagttttacgactctctgttcgatgaa
ctgctgaaatacaacatcgaaccggtgataaccctctcccactttgaaatgccgctgcat
ctggtgcagcaatacggtagctggaccaaccgtaaattcgttgatttctttgtccgtttc
gcggaagtggtattcgaacgctacaagcataaagtcaaatactggatgaccttcaacgaa
ataaacaaccagcgtaactggcgtgcgccgctgtttggttactgctgctccggcgtggtg
tataccgagcatgacaacccggaagagacgatgtaccaggtgctgcatcaccagtttgtc
gccagcgccctggcagtgaaagccgcgcgtcgcattaacccggagatgaaagtcggctgt
atgctggcgatggtgccgctctatccctactcatgtaacccggacgatgtgatgttcgct
caggtgtcgatgcgcgaacgctacgtctttaccgatgtgcagctatgcggctattacccg
tcctatgtattgaacgagtgggaacgtcgcggatttaatatcaaaatggaagacggcgat
ctcgatgtactgcgcgaaggcacctgcgattatcttggtttcagctattacatgaccaac
gcagtgaaggccgaaggcggcaccggcgatgcgatctctggttttgaaggcagcgtaccg
aacccgtatgttaaagcgtctgactggggctggcagattgatccagtaggtctgcgctat
gccctttgcgaactgtatgagcgttatcagaggccgctgtttattgtcgaaaacggtttt
ggcgcttacgacaaagtggaagaagatggcagcatcaacgacgactaccgcattgactac
ctgcgcgcccatattaaagagatgaaaaaagcagtgacttacgatggtgtggatctgatg
ggctacacaccgtgggctgcatcgactgcgtgtcattcactaccgggcagtacagcaaac
gctacggctttatctatgtga

DBGET integrated database retrieval system