KEGG   Shigella flexneri 8401 (serotype 5b): SFV_3117Help
Entry
SFV_3117          CDS       T00377                                 

Gene name
ebgA
Definition
cryptic beta-D-galactosidase subunit alpha
Orthology
K12111  
evolved beta-galactosidase subunit alpha [EC:3.2.1.23]
Organism
sfv  Shigella flexneri 8401 (serotype 5b)
Pathway
Galactose metabolism
Other glycan degradation
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sfv00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    SFV_3117 (ebgA)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    SFV_3117 (ebgA)
Enzymes [BR:sfv01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     SFV_3117 (ebgA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3184930..3188016
Genome map
AA seq 1028 aa AA seqDB search
MNRWENIQLTHENRLAPRAYFFSYDSVAQARTFARETSSLFLPLSSQWNFHFFDHPLQVP
EAFTSELMADWGHITVPAMWQMEGHGKLQYTDEGFPFPIDVPFVPSDNPTGAYQRIFTLS
DGWQGKQTLIKFDGVETYFEVYVNGQYVGFSKGSRLTAEFDISAMVKTGDNLLCVRVMQW
ADSTYVEDQDMWWSAGIFRDVYLVGKHLTHINDFTVRTDFDEAYCDATLSCEVVLENLAA
SPVVTTLEYTLFDGERVVHSSAIDHLAIEKLTSASFAFTVEQPQQWSAESPYLYHLVMTL
KDANGNVLEVVPQRVGFRDIKVRDGLFWINNRYVMLHGVNRHDNDHRKGRAVGMDRVEKD
LQLMKQHNINSVRTAHYPNDPRFYELCDIYGLFVMAETDVESHGFANVGDISRITDDPQW
EKVYVERIVRHIHAQKNHPSIIIWSLGNESGYGCNIRAMYHAAKALDDTRLVHYEEDRDA
EVVDIISTMYTRVPLMNEFGEYPHPKPRIICEYAHAMGNGPGGLTEYQNVFYKHDCIQGH
YVWEWCDHGIQAQDDHGNVWYKFGGDYGDYPNNYNFCLDGLIYSDQTPGSGLKEYKQVIA
PVKIHALTRGELKVENKLWFTTLDDYTLHAEVRAEGETLATQQIKLRDVAPNSEAPLQIT
LPQLDAREAFLNITVTKDSRTRYSEAGHSIATYQFPLKENTAQPVPFAPNNARPLTLEDD
RLSCTVRGYNFAITFSKMSGKPTSWQVNGESLLTREPKINFFKPMIDNHKQEYEGLWQPN
HLQIMQEHLRDFAVEQSDGEVLIISRTVIAPPVFDFGMRCTYIWRIAADGQVNVALSGER
YGDYPHIIPCIGFTMGINGEYDQVAYYGRGPGENYADSQQANIIDIWRSTVDAMFENYPF
PQNNGNRQHVRWTALTNRHGNGLLVVPQRPINFSAWHYTQENIHAAQHCNELQRSDDITL
NLDHQLLGLGSNSWGSEVLDSWRVWFRDFSYGFTLLPVSGGEATAQSLASYEFGAGFFST
NLHSENKQ
NT seq 3087 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgctgggaaaacattcagctcacccacgaaaaccgacttgcgccgcgtgcgtac
tttttttcatatgattctgttgcgcaagcgcgtacctttgcccgcgaaaccagcagcctg
tttctgcccttaagcagtcagtggaatttccacttttttgaccatccgctgcaagtacca
gaagccttcacctctgagttaatggctgactgggggcatattaccgtccccgccatgtgg
caaatggaaggtcacggcaaactgcaatataccgacgaaggttttccgttccccatcgat
gtgccgtttgtccccagcgataacccaaccggtgcctatcaacgtattttcaccctcagc
gacggctggcagggtaaacagacgctgattaaatttgacggcgtcgaaacctattttgaa
gtctacgttaacggtcagtatgtgggtttcagcaagggcagtcgcctgaccgcagagttt
gacatcagcgcgatggttaaaaccggcgacaacctgttgtgtgtgcgcgtgatgcagtgg
gcggactctacctacgtggaagaccaggatatgtggtggtcggcggggatcttccgcgat
gtttatctggtcggaaaacacctaacgcatattaacgatttcactgtgcgtaccgacttt
gacgaagcctattgcgatgccacgctttcctgcgaagtggtgctggaaaatctcgccgcc
tcccctgtcgtcacgacgctggaatataccctgtttgatggcgaacgcgtggtgcacagc
agcgccattgatcatttggcaattgaaaaactgaccagcgccagctttgcttttactgtc
gaacagccgcagcaatggtcagcagaatccccttatctttaccatctggtcatgacgctg
aaagacgccaacggcaacgttctggaagtggtgccacaacgcgttggcttccgtgatatc
aaagtgcgcgacggtctgttctggatcaataaccgttatgtgatgctgcacggcgtcaac
cgtcacgacaacgatcatcgcaaaggccgcgccgttggaatggatcgcgtcgagaaagat
ctccagttgatgaagcagcacaatatcaactccgtgcgtaccgctcactacccgaacgat
ccgcgtttttacgaactgtgtgatatctacggcctgtttgtgatggcggaaaccgacgtc
gaatcgcacggctttgctaatgtcggcgatatcagccgtattaccgacgatccgcagtgg
gaaaaagtctacgtcgagcgcattgttcgccatatccacgcacagaaaaaccatccgtcg
atcatcatctggtcgctgggcaatgaatccggctatggctgtaacatccgcgcgatgtac
catgcggcgaaagcgctggatgacacgcgactggttcattacgaagaagatcgcgatgct
gaagtggtcgatattatttccaccatgtacacccgcgtgccgctgatgaatgagtttggt
gaatacccgcatccgaagccgcgcatcatctgtgaatatgctcatgcgatggggaacgga
ccgggcgggctgacggagtaccagaacgtcttctataagcacgattgcattcagggtcat
tatgtctgggagtggtgcgaccacgggatccaggcacaggacgaccacggcaatgtctgg
tataaattcggcggcgactacggcgactatcccaacaactataacttctgtcttgatggt
ttgatctattccgatcagacgccgggatcgggcctgaaagagtacaaacaggttatcgcg
ccggtaaaaatccacgcgctgactcgcggcgagttgaaagtcgaaaataaactgtggttt
accacgcttgatgactacaccctgcacgcagaggtgcgcgccgaaggtgaaacgctcgcg
acgcagcagattaaactgcgcgacgttgcgccgaacagcgaagcccccttgcagatcacg
ctgccgcagctggacgcccgcgaagcgttcctcaacattacggtgaccaaagattcccgc
acccgctacagcgaagccgggcattctatcgccacttatcagttcccgctgaaggaaaac
accgcgcagccagtgcctttcgcaccaaataatgcgcgtccgctgacgctggaagacgat
cgtttgagctgcaccgttcgcggctacaacttcgcgatcaccttctcaaaaatgagtggc
aaaccgacatcctggcaggtaaatggcgagtcgctgctgacccgcgagccaaagatcaac
ttcttcaagccgatgatcgacaaccacaagcaggagtacgaagggttgtggcagccgaat
catttgcagatcatgcaggaacatctgcgcgactttgccgtagaacagagcgatggtgaa
gtgttgatcatcagccgcacagttattgcaccgccggtgtttgacttcgggatgcgctgt
acctacatctggcgcatcgctgccgatggccaggttaacgtggcgctttccggcgagcgt
tacggcgactatccgcacatcattccgtgcatcggtttcaccatggggattaacggcgaa
tacgatcaggtggcgtattacggtcgtggaccgggcgaaaactacgccgacagccagcag
gctaacatcatcgatatctggcgcagcaccgtcgatgccatgttcgagaactatcccttc
ccgcagaacaacggcaaccgtcagcatgtccgctggacggcactgactaaccgccacggc
aacggtctgctggtggttccgcagcgcccaattaacttcagcgcctggcactatacccag
gaaaacatccacgctgcccagcactgtaacgagctgcagcgcagtgatgacatcaccctg
aacctcgaccaccagctacttggcctcggctccaactcctggggcagcgaggtgctggac
tcctggcgcgtctggttccgtgacttcagctacggctttacgttgctgccggtttctggc
ggagaagctaccgcgcaaagtctggcgtcgtatgagttcggcgcagggttcttttccacg
aatttgcacagcgagaataagcaatga

DBGET integrated database retrieval system