KEGG   Shigella flexneri 8401 (serotype 5b): SFV_3654Help
Entry
SFV_3654          CDS       T00377                                 

Gene name
fadB
Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
sfv  Shigella flexneri 8401 (serotype 5b)
Pathway
sfv00071  Fatty acid degradation
sfv00280  Valine, leucine and isoleucine degradation
sfv00281  Geraniol degradation
sfv00310  Lysine degradation
sfv00362  Benzoate degradation
sfv00380  Tryptophan metabolism
sfv00410  beta-Alanine metabolism
sfv00640  Propanoate metabolism
sfv00650  Butanoate metabolism
sfv00903  Limonene and pinene degradation
sfv00930  Caprolactam degradation
sfv01040  Biosynthesis of unsaturated fatty acids
sfv01100  Metabolic pathways
sfv01110  Biosynthesis of secondary metabolites
sfv01120  Microbial metabolism in diverse environments
sfv01130  Biosynthesis of antibiotics
sfv01200  Carbon metabolism
sfv01212  Fatty acid metabolism
Module
sfv_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:sfv00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SFV_3654 (fadB)
   00650 Butanoate metabolism
    SFV_3654 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    SFV_3654 (fadB)
   01040 Biosynthesis of unsaturated fatty acids
    SFV_3654 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SFV_3654 (fadB)
   00310 Lysine degradation
    SFV_3654 (fadB)
   00380 Tryptophan metabolism
    SFV_3654 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SFV_3654 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SFV_3654 (fadB)
   00281 Geraniol degradation
    SFV_3654 (fadB)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SFV_3654 (fadB)
   00930 Caprolactam degradation
    SFV_3654 (fadB)
Enzymes [BR:sfv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     SFV_3654 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     SFV_3654 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     SFV_3654 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     SFV_3654 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: ABF05679
UniProt: Q0SZ36
Position
3739746..3741935
Genome map
AA seq 729 aa AA seqDB search
MLYKGDTLYLDWLEDGIAELVFDAPGSVNKLDTATVASLGEAIGVLEQQSDLKGLLLRSN
KAAFIVGADITEFLSLFLVPEEQLSQWLHFANSVFNRLEDLPVPTIAAVNGYALGGGCEC
VLATDYRLATPDLRIGLPETKLGIMPGFGGSVRMPRMLGADSALEIIAAGKDVGADQALK
IGLVDGVVKAEKLIEGAMAILRQAINGDLDWKAKRQPKQEPLKLSKIEATMSFTIAKGMV
AQTAGKHYPAPITAVKTIEAAARFGREEALNLENKSFVPLAHTNEARALVGIFLNDQYVK
GKAKKLTKDVETPKQAAVLGAGIMGGGIAYQSAWKGVPVVMKDINDKSLTLGMTEAAKLL
NKQLERGKIDGLKLAGVISTIHPTLDYAGFDRVDIVVEAVVENPKVKKAVLAETEQKVRQ
DTVLASNTSTIPISELANALERPENFCGMHFFNPVHRMPLVEIIRGEKSSDETIAKVVAW
ASKMGKTPIVVNDCPGFFVNRVLFPYFAGFSQLLRDGADFRKIDKVMEKQFGWPMGPAYL
LDVVGIDTAHHAQAVMAAGFPQRMQKDYRDAIDALFDANRFGQKNGLGFWRYKEDSKGKP
KKEEDAAVEDLLAEVSQPKRDFSEEEIIARMMIPMVNEVVRCLEEGIIATPAEADMALVY
GLGFPPFHGGAFRWLDTLGSAKYLDMAQQYQHLGPLYEVPEGLRNKARHNEPYYPPVEPA
RPVGDLKTA
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgctttacaaaggcgacaccctgtaccttgactggctggaagatggcattgccgaactg
gtatttgatgccccaggttcagttaataaactcgacactgcgaccgtcgccagcctcggc
gaggccatcggcgtgctggaacagcaatcagatctaaaagggctgctgctgcgttcgaac
aaagcagcctttatcgtcggtgctgatatcaccgaatttttgtccctgttcctcgttcct
gaagaacagttaagtcagtggctgcactttgccaatagcgtgtttaatcgcctggaagat
ctgccggtgccgaccattgctgccgtcaacggctatgcgctgggtggtggctgcgaatgc
gtgctggcgaccgattatcgtctggcgacgccggatctgcgcatcggtctgccggaaacc
aaactgggcatcatgccgggctttggcggttctgtacgtatgccacgtatgctgggcgct
gacagtgcactggaaatcattgccgccggtaaagatgtcggcgcggatcaggcgctgaaa
atcggtctggtggatggcgtagtcaaagcagaaaaactgattgaaggggcgatggcgatt
ttacgccaggccattaacggcgacctcgactggaaagcgaaacgtcagccgaagcaggaa
ccgctaaaactgagcaagattgaagccaccatgagcttcaccatcgctaaaggaatggtc
gcgcaaacggcggggaaacattatccggcccccatcaccgcagtaaaaaccattgaagct
gcggcccgttttggtcgtgaagaagccttaaatctggaaaacaaaagttttgtcccgctg
gcgcataccaacgaagctcgcgcactggtcggcattttccttaacgatcaatatgtaaaa
ggcaaagcgaagaaactcaccaaagacgttgaaaccccgaaacaggctgctgtgctgggc
gcaggcatcatgggtggcggtatcgcttaccagtccgcgtggaaaggcgtgccggttgtc
atgaaagatatcaacgacaagtcgttaaccctcggcatgaccgaagccgcgaaactgctg
aacaagcagcttgagcgcggcaaaatcgatggtctgaaactggctggcgtgatctccacg
atccacccaacgctcgactacgccggatttgaccgcgtggatattgtggtagaagcggtt
gttgaaaacccgaaagtgaaaaaagccgtactggcagaaaccgaacaaaaagtacgccag
gataccgtgctggcgtctaacacttcaaccattcctatcagcgaactggccaacgcgctg
gaacgcccggaaaacttctgcgggatgcacttctttaacccggtccaccgaatgccgttg
gtagaaattattcgcggcgagaaaagctccgacgaaaccatcgcgaaagttgtcgcctgg
gcgagcaagatgggcaagacgccgattgtggttaacgactgccccggcttctttgttaac
cgcgtgctgttcccgtatttcgccggtttcagccagctgctgcgcgacggcgcggatttc
cgcaagatcgacaaagtgatggaaaaacagtttggctggccgatgggcccggcatatctg
ctggacgttgtgggcattgataccgcgcatcacgctcaggctgtcatggcagcaggcttc
ccgcagcggatgcagaaagattaccgcgatgccatcgacgcgctgtttgatgccaaccgc
tttggtcagaagaacggcctcggtttctggcgttataaagaagacagcaaaggtaagccg
aagaaagaagaagacgccgccgttgaagacctgctggcagaagtgagccaaccgaagcgc
gatttcagcgaagaagagattatcgcccgcatgatgatcccgatggtcaacgaagtggtg
cgctgtctggaagagggcattatcgccactccggcggaagcggatatggcgctggtctac
ggcctgggcttccctccgttccacggcggcgcgttccgctggctggacaccctcggtagc
gcaaaatacctcgatatggcacagcaatatcagcacctcggcccgctgtatgaagtgccg
gaaggtctgcgtaataaagcgcgtcataacgaaccgtactatcctccggttgagccagcc
cgtccggttggcgacctgaaaacggcttaa

DBGET integrated database retrieval system