KEGG   Shigella flexneri 8401 (serotype 5b): SFV_3673Help
Entry
SFV_3673          CDS       T00377                                 

Gene name
pldB
Definition
lysophospholipase L2 (EC:3.1.1.5)
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
sfv  Shigella flexneri 8401 (serotype 5b)
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:sfv00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    SFV_3673 (pldB)
Enzymes [BR:sfv01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     SFV_3673 (pldB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3760334..3761299)
Genome map
AA seq 321 aa AA seqDB search
MGPLTDFCRQRDEAEFTGVDDIPVRFVRFRAQHHDRVVVICPGRIESYVKYAELAYDLFH
LGFDVLIIDHRGQGRSGRLLADPHLGHVNRFNDYVDDLAAFWQQEVQPGPWRKRYILAHS
MGGAISTLFLQRHPGVCDAIALTAPMFGIVIRMPSFMARQILNWAEAHPRFRDGYAIGTG
RWRALPFAINVLTHSRQRYRRNLRFYADDPTIRVGGPTYHWVRESILAGEQVLAGAGDDA
TQTLLLQAEEERVVDNRMHDRFCELRTAAGHPVEGGRPLVIKGAYHEILFEKDAMRSVAL
HAIVDFFNRHNSPSGNRSTEV
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgggaccgctgactgatttctgtcgtcagcgtgatgaagcagagtttactggtgtggat
gacattccggtgcgctttgtccgttttcgcgcacagcaccatgaccgggtggtagtcatc
tgcccggggcgtattgagagctacgtaaaatatgcggaactggcctacgacctgttccat
ttggggtttgatgtcttaatcatcgaccatcgcgggcagggacgttccggtcgcctgtta
gccgatccgcatctcgggcatgttaatcgctttaatgattatgttgatgatctggcggca
ttctggcagcaggaggttcagcccggtccgtggcgtaaacgctatatactggcacattcg
atgggcggtgcgatctccacattatttctgcaacgccatccaggtgtatgtgacgccatt
gcgctaactgcgccaatgtttgggatcgtgattcgtatgccgtcatttatggcacggcag
atcctcaactgggccgaagcgcatccacgtttccgtgatggctatgcaataggcaccggg
cgctggcgcgcgttgccgtttgctatcaacgtactgacccacagcagacagcgatatcga
cgtaacttacgcttctatgctgatgacccaacgattcgcgtcggtgggccgacctaccat
tgggtacgcgaaagtattctggctggcgaacaggtgttagccggtgcgggtgatgacgcc
acgcaaacgcttctcttacaagctgaagaggaacgcgtggtggataaccgcatgcacgac
cgtttttgtgaactccgcaccgccgcgggccatcctgtcgaaggaggacggccgttggta
ataaaaggtgcttaccatgagatcctttttgaaaaggacgcaatgcgctcagtcgcgctc
cacgccatcgttgattttttcaacaggcataactcacccagcggaaaccgctctacagag
gtttaa

DBGET integrated database retrieval system